Property Summary

NCBI Gene PubMed Count 21
Grant Count 4
R01 Count 4
Funding $123,048.1
PubMed Score 13.64
PubTator Score 14.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (12)

PMID Text
24867948 FIH-1-Mint3 axis does not control HIF-1 transcriptional activity in nucleus pulposus cells.
24742670 Mints are necessary for activity-induced APP and PS1 trafficking and provide insight into the cellular fate of APP in endocytic pathways essential for Abeta production.
23965993 Strict specificity for recruitment of the Mint3 adaptor by APP at the Golgi, a critical role for Tyr-682 (within the YENPTY motif) in Mint3 recruitment and export of APP from the Golgi, are demonstrated.
21178287 These results indicate that all three amyloid beta protein precursor family members are capable of activating gene transcription via Mint3-Taz and Mint3-Yap.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20016085 Two transcriptional coactivators, TAZ and YAP, functionally associate with amyloid precursor protein through Mint3 and form transcriptionally active triple protein complexes.
19726677 Mint3 regulates the FIH-1-HIF-1 pathway, which controls ATP production in macrophages
18544638 the interaction between the PTB domain of Mint3 and the acidic peptide signal of Furin regulates the specific localization of Furin in the trans-Golgi network
17959829 These data implicate Mint3 activity as a critical determinant of post-Golgi APP traffic.
15494376 We have examined the ability of Bcr to interact with other epithelial PDZ proteins and found specific binding to both the apical PDZK1 protein and the Golgi-localized Mint3
More...

AA Sequence

MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQELVQQFEALPGD      1 - 70
LVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEECPPSQTGPEEPLEPAPRLLQ     71 - 140
PPEDPDEDSDSPEWVEGASAEQEGSRSSSSSPEPWLETVPLVTPEEPPAGAQSPETLASYPAPQEVPGPC    141 - 210
DHEDLLDGVIFGARYLGSTQLVSERNPPTSTRMAQAREAMDRVKAPDGETQPMTEVDLFVSTKRIKVLTA    211 - 280
DSQEAMMDHALHTISYTADIGCVLVLMARRRLARRPAPQDHGRRLYKMLCHVFYAEDAQLIAQAIGQAFA    281 - 350
AAYSQFLRESGIDPSQVGVHPSPGACHLHNGDLDHFSNSDNCREVHLEKRRGEGLGVALVESGWGSLLPT    351 - 420
AVIANLLHGGPAERSGALSIGDRLTAINGTSLVGLPLAACQAAVRETKSQTSVTLSIVHCPPVTTAIIHR    421 - 490
PHAREQLGFCVEDGIICSLLRGGIAERGGIRVGHRIIEINGQSVVATPHARIIELLTEAYGEVHIKTMPA    491 - 560
ATYRLLTGQEQPVYL                                                           561 - 575
//

Text Mined References (27)

PMID Year Title
24867948 2014 FIH-1-Mint3 axis does not control HIF-1 transcriptional activity in nucleus pulposus cells.
24742670 2014 Mint proteins are required for synaptic activity-dependent amyloid precursor protein (APP) trafficking and amyloid ? generation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23965993 2013 Recruitment of the Mint3 adaptor is necessary for export of the amyloid precursor protein (APP) from the Golgi complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21178287 2011 Signaling via amyloid precursor-like proteins APLP1 and APLP2.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20016085 2009 Novel mediators of amyloid precursor protein signaling.
More...