Property Summary

Ligand Count 44
NCBI Gene PubMed Count 474
PubMed Score 978.74
PubTator Score 885.31

Knowledge Summary

Patent (45,013)

TINX Plot

  Disease (10)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
DOID:2627 94 0.0 1.2
Kidney cancer 2613 0.0 1.0
Disease Target Count Z-score Confidence
Gastrointestinal system cancer 3 0.0 3.0
Glaucoma 239 0.0 3.0
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 1.2
ovarian cancer 8520 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 5.899 2.9
Disease Target Count Z-score Confidence
Ataxia telangiectasia 34 4.819 2.4
Nijmegen breakage syndrome 24 4.446 2.2

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.124 2.2e-03
atypical teratoid / rhabdoid tumor 1.400 8.1e-07
glioblastoma 1.300 6.3e-07
group 3 medulloblastoma 1.500 9.3e-04
lung cancer 2.000 3.3e-04
malignant mesothelioma 1.200 1.5e-05
medulloblastoma, large-cell 2.100 2.1e-06
non-small cell lung cancer 1.441 1.6e-16
pediatric high grade glioma 1.100 1.4e-05
primitive neuroectodermal tumor 1.100 1.3e-03
tuberculosis 1.400 4.7e-06

Gene RIF (487)

AA Sequence

MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQE      1 - 70
LYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYS     71 - 140
KKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQS    141 - 210
VYPKALRDEYIMSKTLGSGACGEVKLAFERKTCKKVAIKIISKRKFAIGSAREADPALNVETEIEILKKL    211 - 280
NHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKP    281 - 350
ENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFIC    351 - 420
LSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDED    421 - 490
MKRKFQDLLSEENESTALPQVLAQPSTSRKRPREGEAEGAETTKRPAVCAAVL                     491 - 543
//

Text Mined References (483)

PMID Year Title