Property Summary

NCBI Gene PubMed Count 452
Grant Count 510
R01 Count 365
Funding $44,342,968.35
PubMed Score 933.47
PubTator Score 885.31

Knowledge Summary

Patent (45,013)

Expression

  Differential Expression (11)

Synonym

Accession O96017 A8K3Y9 B7ZBF3 B7ZBF4 B7ZBF5 Q6QA03 Q6QA04 Q6QA05 Q6QA06 Q6QA07 Q6QA08 Q6QA10 Q6QA11 Q6QA12 Q6QA13 Q9HBS5 Q9HCQ8 Q9UGF0 Q9UGF1
Symbols CDS1
CHK2
LFS2
RAD53
hCds1
HuCds1
PP1425

Gene

PDB

1GXC   2CN5   2CN8   2W0J   2W7X   2WTC   2WTD   2WTI   2WTJ   2XBJ   2XK9   2XM8   2XM9   2YCF   2YCQ   2YCR   2YCS   2YIQ   2YIR   2YIT   3I6U   3I6W   3VA4   4A9R   4A9S   4A9T   4A9U   4BDA   4BDB   4BDC   4BDD   4BDE   4BDF   4BDG   4BDH   4BDI   4BDJ   4BDK  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (468)

PMID Text
26991782 CHEK2 mutation carriers were characterized by older age, a history of gastric cancer in the family, locally advanced disease, lower histologic grade and luminal B type breast cancer.
26831064 loss of CHK2 or PP6C-SAPS3 promotes Aurora-A activity associated with BRCA1 in mitosis
26577449 The aim of this study was to determine the frequency and spectrum of germline mutations in BRCA1, BRCA2 and PALB2 and to evaluate the presence of the CHEK2 c.1100delC allele in these patients.
26573794 Authors propose that CHK2 is a negative regulator of androgen sensitivity and prostate cancer growth, and that CHK2 signaling is lost during prostate cancer progression to castration resistance.
26553136 we observed a great degree of heterogeneity amongst the CHEK2*1100delC breast cancers, comparable to the BRCAX breast cancers. copy number aberrations were mostly seen at low frequencies in both the CHEK2*1100delC and BRCAX group of breast cancers.
26506619 germ-line CHEK2 mutations affecting protein coding sequence confer a moderately-increased risk of NHL, they are associated with an unfavorable NHL prognosis, and they may represent a valuable predictive biomarker for patients with DLBCL.
26483394 CHEK2 mutation is associated with Pancreatic Cancer.
26447757 Data suggest that nitroxoline induces anticancer activity through AMP-activated kinase (AMPK)/mTOR serine-threonine kinase (mTOR) signaling pathway via checkpoint kinase 2 (Chk2) activation.
26424751 Variants at the CHEK2 locus are associated with risk of invasive epithelial ovarian cancer. [meta-analysis]
26084796 The germline mutations of the CHEK2 gene are associated with an increased risk of polycythaemia vera.
More...

AA Sequence

MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQE      1 - 70
LYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYS     71 - 140
KKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQS    141 - 210
VYPKALRDEYIMSKTLGSGACGEVKLAFERKTCKKVAIKIISKRKFAIGSAREADPALNVETEIEILKKL    211 - 280
NHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKP    281 - 350
ENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFIC    351 - 420
LSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDED    421 - 490
MKRKFQDLLSEENESTALPQVLAQPSTSRKRPREGEAEGAETTKRPAVCAAVL                     491 - 543
//

Text Mined References (461)

PMID Year Title
26991782 2016 A Comparison between CHEK2*1100delC/I157T Mutation Carrier and Noncarrier Breast Cancer Patients: A Clinicopathological Analysis.
26831064 2016 CHK2-BRCA1 tumor-suppressor axis restrains oncogenic Aurora-A kinase to ensure proper mitotic microtubule assembly.
26577449 2015 BRCA1, BRCA2 and PALB2 mutations and CHEK2 c.1100delC in different South African ethnic groups diagnosed with premenopausal and/or triple negative breast cancer.
26573794 2015 Checkpoint Kinase 2 Negatively Regulates Androgen Sensitivity and Prostate Cancer Cell Growth.
26553136 2015 Genomic profiling of CHEK2*1100delC-mutated breast carcinomas.
26506619 2015 Association of Germline CHEK2 Gene Variants with Risk and Prognosis of Non-Hodgkin Lymphoma.
26483394 2016 Prevalence of Pathogenic Mutations in Cancer Predisposition Genes among Pancreatic Cancer Patients.
26447757 2015 Repurposing of nitroxoline as a potential anticancer agent against human prostate cancer: a crucial role on AMPK/mTOR signaling pathway and the interplay with Chk2 activation.
26424751 2015 Common variants at the CHEK2 gene locus and risk of epithelial ovarian cancer.
26084796 2016 The germline mutations of the CHEK2 gene are associated with an increased risk of polycythaemia vera.
More...