Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.32
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Mirror movements 3 1 0.0 0.0
Disease Target Count P-value
oligodendroglioma 2850 9.0e-03
Disease Target Count Z-score Confidence
Situs Inversus 65 4.265 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
oligodendroglioma -1.100 9.0e-03

Gene RIF (2)

AA Sequence

MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWH      1 - 70
VVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS                                        71 - 105
//

Text Mined References (17)

PMID Year Title