Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.12
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Situs Inversus 48 4.267 2.1
oligodendroglioma 2,849

Expression

  Differential Expression (1)

Disease log2 FC p
oligodendroglioma -1.100 0.009

Synonym

Accession O96015 Q6FGB2 Q6FGD0
Symbols MRMV3
PIG27

Gene

Gene RIF (2)

PMID Text
25236653 No mutation in DNAL4 in Congenital mirror movements.
25098561 DNAL4 may play a role in the cytoplasmic dynein complex for netrin-1-directed retrograde transport, and in commissural neurons of the corpus callosum in particular. This could lead to faulty cross-brain wiring, resulting in Mirror movements (MRMV).

AA Sequence

MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWH      1 - 70
VVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS                                        71 - 105
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25236653 2014 Congenital mirror movements: no mutation in DNAL4 in 17 index cases.
25098561 2014 Identification of a homozygous splice site mutation in the dynein axonemal light chain 4 gene on 22q13.1 in a large consanguineous family from Pakistan with congenital mirror movement disorder.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
21516116 2011 Next-generation sequencing to generate interactome datasets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15454493 2005 Identification of cooperative genes for NUP98-HOXA9 in myeloid leukemogenesis using a mouse model.
More...