Property Summary

NCBI Gene PubMed Count 36
Grant Count 47
R01 Count 38
Funding $3,698,743.53
PubMed Score 113.71
PubTator Score 56.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer 1.800 0.000
posterior fossa group A ependymoma 1.300 0.001
ductal carcinoma in situ -1.300 0.043
invasive ductal carcinoma -1.400 0.020
Breast cancer 1.100 0.041

 GWAS Trait (1)

Gene RIF (28)

PMID Text
27386628 Demonstrate immunohistochemical expression of Wnt11 and BCL2A1 in complete moles and normal villi.
26818191 The Wnt11 gene plays an important role in human mesenchymal stromal cells for enhancing the osteogenesis in an infectious environment.
26261605 Report high expression of Wnt11 in esophageal squamous cell carcinoma, which was significantly associated with AJCC stage.
24737009 High expression of Wnt-11 is associated with metastasis in cervical cancer.
24606488 differential Wnt11 immunoexpression in high-grade human serous ovarian cancer compared to low-grade human serous ovarian cancer could play important roles in serous ovarian cancer progression and may be modulated by Wnt5a expression levels.
24082114 Estrogen/progesterone treatment of mature myometrial cells induced expression of WNT11 and WNT16, which remained constitutively elevated in leiomyoma tissues.
23549873 Data established a seven-gene (AR, ESR2, GATA3, GBX2, KRT16, MMP28 and WNT11) prognostic signature to define a subset of triple-negative breast cancer (TNBC).
22715413 Notch1-induced WISP-1 expression appeared to be Wnt11-dependent, but Wnt1-independent
22161723 Wnt11 mRNA expression was significantly higher in the stage I, II, III, or IV colorectal tumor tissues than in non-tumor colon.
21903761 Wnt11 is involved in the protection of the host intestinal cells by blocking the invasion of pathogenic bacteria, suppressing inflammation, and inhibiting apoptosis.
More...

AA Sequence

MRARPQVCEALLFALALQTGVCYGIKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCRSNLELMHTVV      1 - 70
HAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAAAISHAIARACTSGDLPGCSC     71 - 140
GPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLEMKCK    141 - 210
CHGVSGSCSIRTCWKGLQELQDVAADLKTRYLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSP    211 - 280
DFCMKNEKVGSHGTQDRQCNKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVER    281 - 350
YVCK                                                                      351 - 354
//

Text Mined References (37)

PMID Year Title
27386628 2016 Immunohistochemical Expression and Clinical Significance of Wnt11 and BCL2A1 in Complete Moles.
26818191 2016 Wnt11 plays an important role in the osteogenesis of human mesenchymal stem cells in a PHA/FN/ALG composite scaffold: possible treatment for infected bone defect.
26261605 2015 Expression of Wnt11 and Rock2 protein with clinical characteristics of esophageal squamous cell carcinoma in Kazakh and Han patients.
25416956 2014 A proteome-scale map of the human interactome network.
24737009 2014 Clinical significance of Wnt-11 and squamous cell carcinoma antigen expression in cervical cancer.
24606488 2014 Differential Wnt11 expression related to Wnt5a in high- and low-grade serous ovarian cancer: implications for migration, adhesion and survival.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24082114 2013 Paracrine activation of WNT/?-catenin pathway in uterine leiomyoma stem cells promotes tumor growth.
23549873 2013 Identification of prognosis-relevant subgroups in patients with chemoresistant triple-negative breast cancer.
22715413 2012 Inhibition of fibroblast growth by Notch1 signaling is mediated by induction of Wnt11-dependent WISP-1.
More...