Property Summary

NCBI Gene PubMed Count 89
PubMed Score 170.94
PubTator Score 89.43

Knowledge Summary

Patent (17,386)


  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 3.18376435927947E-9
malignant mesothelioma 3163 1.65270413205518E-7
glioblastoma 5572 2.69861155616019E-7
medulloblastoma, large-cell 6234 1.3296427849544E-5
osteosarcoma 7933 0.00277284603185255
Disease Target Count Z-score Confidence
Breast adenoma 4 3.918 2.0
Cancer 2346 3.826 1.9


  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
osteosarcoma 1.224 0.003
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.100 0.000




2OV2   2BVA   2CDZ   2J0I   2Q0N   2X4Z   4APP   4FIE   4FIF   4FIG   4FIH   4FII   4FIJ   4JDH   4JDI   4JDJ   4JDK   4L67   4NJD   4O0V   4O0X   4O0Y   4XBR   4XBU   5BMS  

  Ortholog (13)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (64)

26841865 PAK4 methylation by SETD6 promotes the activation of the Wnt/beta-catenin pathway.
26607847 PAK4 catalytic domain binds cellular ATP and the Inka1 inhibitor. The crystal lattice consists only of PAK4-PAK4 contacts, which form a hexagonal array with channels of 80 A in diameter that run the length of the crystal.
26598620 PAK4 and RhoU cooperate to drive adhesion turnover and promote cell migration.
26546043 data show decreased nuclear accumulation and transcriptional activity of STAT3 in PAK4-silenced pancreatic cancer cells
26411419 Study has confirms prognostic role of PAK4 level in cervical cancer patients and recognizes the regulatory role in cervical cancer progression. PAK4 also confers the chemoresistance of cervical cancer cells in a PI3K/Akt-dependent way.
26218748 Nuclear Pak4 is involved in the pathogenesis of endometrial cancer especially in postmenopausal women.
26124003 this report reveals that high level of p-Pak4 correlates with poor prognosis in gastric cancer (GC), thereby suggesting that p-Pak4 might be a potential prognostic marker for GC.
26068882 PAK4 localizes to cell-cell junctions and contributes to estblishing cell polarity.PAK4 phosphorylate beta-catenin Serine-675.PAK4 binding to cell-cell junctions is dependent on Cdc42.
25975262 PAK4 mediated LIMK1 phosphorylation regulates the migration and invasion in NSCLC. Therefore, PAK4 might be a significant prognostic marker and potential therapeutic molecular target in NSCLC.
25791829 PAK1 and PAK4 expression were associated with colorectal cancer metastasis and infiltration

AA Sequence

ATAAELLKHPFLAKAGPPASIVPLMRQNRTR                                           561 - 591

Text Mined References (106)

PMID Year Title
26841865 2016 PAK4 Methylation by SETD6 Promotes the Activation of the Wnt/?-Catenin Pathway.
26607847 2015 An in cellulo-derived structure of PAK4 in complex with its inhibitor Inka1.
26598620 2015 PAK4 promotes kinase-independent stabilization of RhoU to modulate cell adhesion.
26546043 2016 p-21 activated kinase 4 (PAK4) maintains stem cell-like phenotypes in pancreatic cancer cells through activation of STAT3 signaling.
26411419 2015 PAK4 confers the malignance of cervical cancers and contributes to the cisplatin-resistance in cervical cancer cells via PI3K/AKT pathway.
26218748 2015 p21-Activated Kinases 1, 2 and 4 in Endometrial Cancers: Effects on Clinical Outcomes and Cell Proliferation.
26124003 2015 Activated Pak4 expression correlates with poor prognosis in human gastric cancer patients.
26068882 2015 The Cdc42 Effector Kinase PAK4 Localizes to Cell-Cell Junctions and Contributes to Establishing Cell Polarity.
25975262 2015 Overexpression of P21-activated kinase 4 is associated with poor prognosis in non-small cell lung cancer and promotes migration and invasion.
25791829 2015 P21-activated kinase 1 and 4 were associated with colorectal cancer metastasis and infiltration.