Property Summary

Ligand Count 49
NCBI Gene PubMed Count 102
PubMed Score 194.69
PubTator Score 89.43

Knowledge Summary

Patent (17,386)


  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 4.007 2.0
Breast adenoma 4 3.838 1.9


  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 3.2e-09
glioblastoma 1.200 2.7e-07
malignant mesothelioma 1.900 1.7e-07
medulloblastoma, large-cell 1.100 1.3e-05
osteosarcoma 1.114 1.4e-04

Protein-protein Interaction (6)

Gene RIF (76)

AA Sequence

ATAAELLKHPFLAKAGPPASIVPLMRQNRTR                                           561 - 591

Text Mined References (119)

PMID Year Title