Property Summary

NCBI Gene PubMed Count 24
Grant Count 5
R01 Count 5
Funding $276,349.2
PubMed Score 10.19
PubTator Score 11.60

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O96011 B3KN85 B4DXH9 Q96ET2
Symbols PEX14B
PEX11-BETA

Gene

Gene RIF (6)

PMID Text
23308220 Self-interaction of human Pex11beta during peroxisomal growth and division regulates its membrane deforming activity in conjunction with membrane lipids.
22581969 A new study identifies the first patient with a mutation in PEX11beta.These new findings widen the spectrum of clinical and cellular phenotypes of peroxisome biogenesis disorders.
22581968 Excluding mutations in all PEX genes previously implicated in peroxisome biogenesis disorders, it was found that the defect was caused by a homozygous non-sense mutation in the PEX11beta gene.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20826455 coordinates peroxisome membrane proliferation and maintenance
17408615 Fis1 plays important roles in peroxisome division and maintenance of peroxisome morphology in mammalian cells, possibly in a concerted manner with Pex11pbeta and DLP1.

AA Sequence

MDAWVRFSAQSQARERLCRAAQYACSLLGHALQRHGASPELQKQIRQLESHLSLGRKLLRLGNSADALES      1 - 70
AKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMNLSRDAY     71 - 140
EIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPGTPGGGLPQLALKLRLQVLLLARVLRGHPPLLLD    141 - 210
VVRNACDLFIPLDKLGLWRCGPGIVGLCGLVSSILSILTLIYPWLRLKP                         211 - 259
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23308220 2013 Self-interaction of human Pex11p? during peroxisomal growth and division.
22581969 2012 First PEX11? patient extends spectrum of peroxisomal biogenesis disorder phenotypes.
22581968 2012 A novel defect of peroxisome division due to a homozygous non-sense mutation in the PEX11? gene.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20826455 2010 PEX11 family members are membrane elongation factors that coordinate peroxisome proliferation and maintenance.
20531392 2010 The peroxisomal receptor Pex19p forms a helical mPTS recognition domain.
More...