Property Summary

NCBI Gene PubMed Count 52
Grant Count 61
R01 Count 22
Funding $11,323,428.84
PubMed Score 91.68
PubTator Score 82.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer -3.013 0.000
lung carcinoma -5.200 0.000

Synonym

Accession O96009 Q8WWD9
Symbols KAP
Kdap
NAP1
NAPA
SNAPA

Gene

PANTHER Protein Class (3)

Gene RIF (38)

PMID Text
26696549 The immunocytochemical expressions of napsin A and p40 in imprint cytology seem to be of great utility for the accurate histological differentiation of lung cancers.
26469326 CK7, TTF-1 and napsin A are predominantly expressed in primary lung adenocarcinoma patients, with CDX-2 being inconsistently expressed.
26400099 napsin A is aberrantly expressed in a subset of lymphomas
26339401 Combining HNF-1beta and napsin A may distinguish clear cell carcinoma from high-grade serous carcinoma, endometrioid adenocarcinoma and metastatic Krukenberg tumors.
25982999 Low expression levels of NAPSA is associated with lung adenocarcinoma.
25971546 Napsin A is frequently expressed in ovarian and endometrial clear cell carcinomas.
25889632 Napsin A is expressed in a broad spectrum of renal neoplasms.
25551297 In diagnosis of ovarian clear cell carcinoma, Napsin A is specific but of intermediate sensitivity.
25521803 Data indicate that polyclonal but not monoclonal napsin A antibody has a virtually universal nonspecific labeling in mucinous adenocarcinomas of various sites.
25389337 Our study showed that napsin A is an extremely sensitive (100%) marker of ovarian clear cell carcinomas
24721826 napsin A is another sensitive and specific marker for distinguishing ovarian clear cell tumors (especially adenocarcinomas) from other ovarian tumors
24479710 These data suggest that napsin A may be a useful marker for identifying metastatic adenocarcinomas of pulmonary origin
24331839 TTF-1 is more sensitive than napsin for detection of lung sarcomatoid carcinoma, and no cases were positive for napsin but negative for TTF-1
24191930 Napsin A as a marker of clear cell ovarian carcinoma.
24145649 Napsin A is a sensitive and specific biomarker of the clear cell histotype in endometrial carcinomas and accordingly may have diagnostic utility in their histotyping.
23899066 24 cases each of pulmonary and esophageal adenocarcinoma were stained with TTF-1, napsin A, CDX2, 34betaE12, N-cadherin, and IMP3 in an attempt to find an optimal panel for differentiation. IMP3, CDX2, and N-cadherin are superior to either TTF-1 or napsin A.
23681073 A minority of anaplastic and poorly differentiated micropapillary pattern thyroid carcinomas are napsin A positive.
23503645 PAX2 and napsin A have high specificity but low sensitivity and only have limited value in the differential diagnosis of mesotheliomas and renal cell carcinomas
23355200 Mucin-producing neoplasms of the lung infrequently express napsin A, suggesting that immunohistochemical assessment of napsin A may have limited diagnostic usefulness for distinguishing primary and metastatic mucinous adenocarcinomas involving the lung.
23333608 Napsin B was duplicated from napsin A during the early stages of primate evolution, and the subsequent loss of napsin B function during primate evolution reflected ongoing human-specific napsin B pseudogenization
23194051 investigation of expression of NAPSA (a potential diagnostic marker) in lungs/respiratory mucosa of subjects with pulmonary sclerosing hemangioma
22914608 Napsin-A seems to be a useful marker in classifying primary pulmonary neoplasm as adenocarcinomas.
22495379 a useful immunohistochemical marker for differentiation of lung squamous cell carcinoma and adenocarcinoma from other subtypes
22418245 absence of napsin A was an independent prognostic factor for reduced survival time in lung adenocarcinoma
22288963 Nap-A was more specific than thyroid transcription factor 1 for primary lung adenocarcinoma versus all tumors, excluding kidney, independent of tumor type
22198009 None of the 90 squamous cell carcinomas of the lung exhibited napsin A positivity in the neoplastic cells; however, strong napsin A reactivity was observed in hyperplastic type II pneumocytes and in intra-alveolar macrophages entrapped within the tumor.
22156835 napsin A is a useful marker that can assist in the diagnosis of both lung adenocarcinomas and renal cell carcinomas[review]
21838611 Diagnostic utility of PAX8, TTF-1 and napsin A for discriminating metastatic carcinoma from primary adenocarcinoma of the lung.
21717589 Data suggest that the panels of Napsin A, TTF-1, and p63 were effective in identifying histologic type in NSCLC, and that a combination of either Napsin A and p63 or TTF-1 and p63 should be chosen, depending on morphology.
21464700 in combination with thyroid transcription factor-1-positive immunostaining helps in differentiating primary lung adenocarcinoma from metastatic carcinoma in the lung
21164283 Immunohistochemical staining using a combination of TTF-1, napsin A, p63, and CK5/6 allows subclassification of poorly differentiated non-small cell carcinomas on small lung biopsies in most cases.
20830690 Although TTF-1 had a higher sensitivity, napsin-A was useful as a surrogate marker when encountering a poorly differentiated lung adenocarcinoma.
19740516 The combined use of napsin A and thyroid transcription factor-1 results in improved sensitivity and specificity for identifying pulmonary adenocarcinoma in primary lung tumors and in a metastatic setting.
18216060 A general defect in napsin A or cathepsin H expression or activity was not the specific cause for abnormal surfactant accumulation in juvenile pulmonary alveolar proteinosis
18195689 NAPSA suppresses tumor growth independent of its catalytic activity.
13129928 role in the N- and C-terminal processing of pro-surfactant protein-B in type-II pneumocytes
12698189 Napsin is a promising marker for the diagnosis of primary lung adenocarcinoma.
12151090 Pronapsin A gene expression in normal and malignant human lung and mononuclear blood cells

AA Sequence

MSPPPLLQPLLLLLPLLNVEPSGATLIRIPLHRVQPGRRILNLLRGWREPAELPKLGAPSPGDKPIFVPL      1 - 70
SNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQ     71 - 140
YGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQG    141 - 210
LLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAA    211 - 280
ILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNG    281 - 350
VRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG    351 - 420
//

Text Mined References (53)

PMID Year Title
26696549 2015 Expressions of Thyroid Transcription Factor-1, Napsin A, p40, p63, CK5/6 and Desmocollin-3 in Non-Small Cell Lung Cancer, as Revealed by Imprint Cytology Using a Malinol-Based Cell-Transfer Technique.
26469326 2016 CDX-2 Expression in Primary Lung Adenocarcinoma.
26400099 2016 Aberrant expression of napsin A in a subset of malignant lymphomas.
26339401 2015 Diagnostic value of dual detection of hepatocyte nuclear factor 1 beta (HNF-1?) and napsin A for diagnosing ovarian clear cell carcinoma.
25982999 2015 The expression of TTF-1 and Napsin A in early-stage lung adenocarcinoma correlates with the results of surgical treatment.
25971546 2015 Napsin A is frequently expressed in clear cell carcinoma of the ovary and endometrium.
25889632 2015 Immunoexpression of napsin A in renal neoplasms.
25551297 2015 Comparative analysis of Napsin A, alpha-methylacyl-coenzyme A racemase (AMACR, P504S), and hepatocyte nuclear factor 1 beta as diagnostic markers of ovarian clear cell carcinoma: an immunohistochemical study of 279 ovarian tumours.
25521803 2015 Nonspecific reactivity of polyclonal napsin a antibody in mucinous adenocarcinomas of various sites: a word of caution.
25389337 2014 The lung-restricted marker napsin A is highly expressed in clear cell carcinomas of the ovary.
24721826 2015 Napsin A is a specific marker for ovarian clear cell adenocarcinoma.
24479710 2014 Napsin A is a useful marker for metastatic adenocarcinomas of pulmonary origin.
24331839 2014 Immunohistochemical study of 36 cases of pulmonary sarcomatoid carcinoma--sensitivity of TTF-1 is superior to napsin.
24191930 2013 Napsin A as a marker of clear cell ovarian carcinoma.
24145649 2014 Frequent expression of napsin A in clear cell carcinoma of the endometrium: potential diagnostic utility.
23899066 2013 TTF-1 and napsin A do not differentiate metastatic lung adenocarcinomas from primary esophageal adenocarcinomas: proposal of a novel staining panel.
23681073 2013 Napsin A expression in anaplastic, poorly differentiated, and micropapillary pattern thyroid carcinomas.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23503645 2013 Value of PAX8, PAX2, napsin A, carbonic anhydrase IX, and claudin-4 immunostaining in distinguishing pleural epithelioid mesothelioma from metastatic renal cell carcinoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23355200 2013 Napsin A expression in primary mucin-producing adenocarcinomas of the lung: an immunohistochemical study.
23333608 2013 Structural and phylogenetic comparison of napsin genes: the duplication, loss of function and human-specific pseudogenization of napsin B.
23194051 2012 Napsin A is differentially expressed in sclerosing hemangiomas of the lung.
22914608 2013 Applications and limitations of immunohistochemical expression of "Napsin-A" in distinguishing lung adenocarcinoma from adenocarcinomas of other organs.
22495379 2012 Desmoglein-3 and Napsin A double stain, a useful immunohistochemical marker for differentiation of lung squamous cell carcinoma and adenocarcinoma from other subtypes.
22418245 2012 Napsin A is an independent prognostic factor in surgically resected adenocarcinoma of the lung.
22288963 2012 Napsin A, a new marker for lung adenocarcinoma, is complementary and more sensitive and specific than thyroid transcription factor 1 in the differential diagnosis of primary pulmonary carcinoma: evaluation of 1674 cases by tissue microarray.
22198009 2012 A word of caution regarding napsin A expression in squamous cell carcinomas of the lung.
22156835 2012 Napsin A expression in lung and kidney neoplasia: a review and update.
21838611 2012 Diagnostic utility of PAX8, TTF-1 and napsin A for discriminating metastatic carcinoma from primary adenocarcinoma of the lung.
21717589 2011 Comparison of the expression levels of napsin A, thyroid transcription factor-1, and p63 in nonsmall cell lung cancer using cytocentrifuged bronchial brushings.
21464700 2011 Combination of napsin A and TTF-1 immunohistochemistry helps in differentiating primary lung adenocarcinoma from metastatic carcinoma in the lung.
21164283 2011 Subclassification of non-small cell lung carcinomas lacking morphologic differentiation on biopsy specimens: Utility of an immunohistochemical panel containing TTF-1, napsin A, p63, and CK5/6.
20830690 2010 The utility of napsin-A in the identification of primary and metastatic lung adenocarcinoma among cytologically poorly differentiated carcinomas.
19740516 2010 Napsin A and thyroid transcription factor-1 expression in carcinomas of the lung, breast, pancreas, colon, kidney, thyroid, and malignant mesothelioma.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18216060 2008 Cathepsin H and napsin A are active in the alveoli and increased in alveolar proteinosis.
18195689 2008 The aspartic protease napsin A suppresses tumor growth independent of its catalytic activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15048123 2004 Abi1 is essential for the formation and activation of a WAVE2 signalling complex.
14766755 2004 Processing of pulmonary surfactant protein B by napsin and cathepsin H.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
13129928 2003 Involvement of napsin A in the C- and N-terminal processing of surfactant protein B in type-II pneumocytes of the human lung.
12698189 2003 Aspartic proteinase napsin is a useful marker for diagnosis of primary lung adenocarcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12151090 2002 Pronapsin A and B gene expression in normal and malignant human lung and mononuclear blood cells.
10591213 1999 Membrane-anchored aspartyl protease with Alzheimer's disease beta-secretase activity.
10580106 1999 Human napsin A: expression, immunochemical detection, and tissue localization.
10580105 1999 Napsin A, a member of the aspartic protease family, is abundantly expressed in normal lung and kidney tissue and is expressed in lung adenocarcinomas.
9877162 1998 Napsins: new human aspartic proteinases. Distinction between two closely related genes.
9561193 1998 The aspartic proteinases. An historical overview.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8163018 1994 Multiple functions of pro-parts of aspartic proteinase zymogens.