Property Summary

NCBI Gene PubMed Count 52
Grant Count 61
R01 Count 22
Funding $11,323,428.84
PubMed Score 91.68
PubTator Score 82.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer -3.013 0.000
lung carcinoma -5.200 0.000

Synonym

Accession O96009 Q8WWD9
Symbols KAP
Kdap
NAP1
NAPA
SNAPA

Gene

PANTHER Protein Class (3)

Gene RIF (38)

PMID Text
26696549 The immunocytochemical expressions of napsin A and p40 in imprint cytology seem to be of great utility for the accurate histological differentiation of lung cancers.
26469326 CK7, TTF-1 and napsin A are predominantly expressed in primary lung adenocarcinoma patients, with CDX-2 being inconsistently expressed.
26400099 napsin A is aberrantly expressed in a subset of lymphomas
26339401 Combining HNF-1beta and napsin A may distinguish clear cell carcinoma from high-grade serous carcinoma, endometrioid adenocarcinoma and metastatic Krukenberg tumors.
25982999 Low expression levels of NAPSA is associated with lung adenocarcinoma.
25971546 Napsin A is frequently expressed in ovarian and endometrial clear cell carcinomas.
25889632 Napsin A is expressed in a broad spectrum of renal neoplasms.
25551297 In diagnosis of ovarian clear cell carcinoma, Napsin A is specific but of intermediate sensitivity.
25521803 Data indicate that polyclonal but not monoclonal napsin A antibody has a virtually universal nonspecific labeling in mucinous adenocarcinomas of various sites.
25389337 Our study showed that napsin A is an extremely sensitive (100%) marker of ovarian clear cell carcinomas
More...

AA Sequence

MSPPPLLQPLLLLLPLLNVEPSGATLIRIPLHRVQPGRRILNLLRGWREPAELPKLGAPSPGDKPIFVPL      1 - 70
SNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQ     71 - 140
YGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQG    141 - 210
LLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAA    211 - 280
ILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNG    281 - 350
VRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG    351 - 420
//

Text Mined References (53)

PMID Year Title
26696549 2015 Expressions of Thyroid Transcription Factor-1, Napsin A, p40, p63, CK5/6 and Desmocollin-3 in Non-Small Cell Lung Cancer, as Revealed by Imprint Cytology Using a Malinol-Based Cell-Transfer Technique.
26469326 2016 CDX-2 Expression in Primary Lung Adenocarcinoma.
26400099 2016 Aberrant expression of napsin A in a subset of malignant lymphomas.
26339401 2015 Diagnostic value of dual detection of hepatocyte nuclear factor 1 beta (HNF-1?) and napsin A for diagnosing ovarian clear cell carcinoma.
25982999 2015 The expression of TTF-1 and Napsin A in early-stage lung adenocarcinoma correlates with the results of surgical treatment.
25971546 2015 Napsin A is frequently expressed in clear cell carcinoma of the ovary and endometrium.
25889632 2015 Immunoexpression of napsin A in renal neoplasms.
25551297 2015 Comparative analysis of Napsin A, alpha-methylacyl-coenzyme A racemase (AMACR, P504S), and hepatocyte nuclear factor 1 beta as diagnostic markers of ovarian clear cell carcinoma: an immunohistochemical study of 279 ovarian tumours.
25521803 2015 Nonspecific reactivity of polyclonal napsin a antibody in mucinous adenocarcinomas of various sites: a word of caution.
25389337 2014 The lung-restricted marker napsin A is highly expressed in clear cell carcinomas of the ovary.
More...