Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Dyslexia 43 4.613 2.3

AA Sequence

MYSRLFYLKSSYIIYFEPLFSNAIINILSFINSLASPLTIFCFALSAQALSTIFYFRIFIFIFHSWILLF      1 - 70
HFYFTCSFKTYEHQHSKMVPAYRMQSPRALPRTYLYVWPYK                                  71 - 111
//

Text Mined References (3)

PMID Year Title