Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.96
PubTator Score 1.00

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 8.76888988106168E-20
atypical teratoid / rhabdoid tumor 4369 1.26139260728404E-13
medulloblastoma 1524 7.80915015431374E-10
medulloblastoma, large-cell 6234 1.71630230998541E-5
glioblastoma 5572 0.00141670073671946
pediatric high grade glioma 2712 0.00395215684550507
primitive neuroectodermal tumor 3031 0.0139990067795402
Disease Target Count Z-score Confidence
Dyslexia 36 4.606 2.3


  Differential Expression (7)

Gene RIF (1)

19460752 Knockdown of chromosome X open reading frame 1 (CXorf1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

HFYFTCSFKTYEHQHSKMVPAYRMQSPRALPRTYLYVWPYK                                  71 - 111

Text Mined References (6)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9881668 1998 Identification of CXorf1, a novel intronless gene in Xq27.3, expressed in human hippocampus.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.