Property Summary

NCBI Gene PubMed Count 10
Grant Count 56
Funding $9,624,970.5
PubMed Score 172.66
PubTator Score 19.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.100 0.004
tuberculosis -2.100 0.000
lung carcinoma 1.600 0.000
pituitary cancer -1.200 0.003

Gene RIF (4)

PMID Text
22340725 G-substrate plays a role in the NO-sGC-cGMP-PKG pathway, cerebellum-dependent long-term memory, & neuroprotection of the ventral tegmentum and retina. Review.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12955585 Observational study of gene-disease association. (HuGE Navigator)
12955585 Single nucleotide polymorphism in the GSBS gene is associated with hypercholesterolemia

AA Sequence

MMSTEQMQPLELSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPA      1 - 70
LHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPK     71 - 140
AIVEDDEKDGDKIAI                                                           141 - 155
//

Text Mined References (11)

PMID Year Title
22340725 2012 G-substrate: the cerebellum and beyond.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12955585 2003 A promoter SNP (-1323T>C) in G-substrate gene (GSBS) correlates with hypercholesterolemia.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10051666 1999 Molecular identification of human G-substrate, a possible downstream component of the cGMP-dependent protein kinase cascade in cerebellar Purkinje cells.
9920894 1999 Phosphorylation-dependent inhibition of protein phosphatase-1 by G-substrate. A Purkinje cell substrate of the cyclic GMP-dependent protein kinase.
More...