Property Summary

NCBI Gene PubMed Count 10
PubMed Score 185.99
PubTator Score 19.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Hypercholesterolemia, Familial 23 0.0 0.0
Disease Target Count
Hyperlipoproteinemia Type IIa 11
Disease Target Count P-value
lung carcinoma 2843 5.0e-06
tuberculosis 2010 2.3e-05
pituitary cancer 1972 2.8e-03
ependymoma 4679 4.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.100 4.4e-03
lung carcinoma 1.600 5.0e-06
pituitary cancer -1.200 2.8e-03
tuberculosis -2.100 2.3e-05

Gene RIF (4)

AA Sequence

MMSTEQMQPLELSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPA      1 - 70
LHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPK     71 - 140
AIVEDDEKDGDKIAI                                                           141 - 155
//

Text Mined References (11)

PMID Year Title