Property Summary

Ligand Count 1
NCBI Gene PubMed Count 18
PubMed Score 4.51
PubTator Score 2.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.400 3.1e-02
ovarian cancer 2.000 1.1e-05
pancreatic ductal adenocarcinoma liver m... -1.915 6.9e-03

Gene RIF (5)

AA Sequence

MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITE      1 - 70
CKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDL     71 - 140
GAYSSARKCLAKQRQRMLQERKAAKEAAAATS                                          141 - 172
//

Text Mined References (23)

PMID Year Title