Property Summary

NCBI Gene PubMed Count 139
PubMed Score 4.30
PubTator Score 303.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.100 3.3e-02
dermatomyositis 1.200 2.7e-03
diabetes mellitus -1.100 1.4e-02
intraductal papillary-mucinous carcinoma... 1.200 4.6e-02
intraductal papillary-mucinous neoplasm ... 2.000 1.1e-02
lung cancer -1.700 1.4e-03
oligodendroglioma -1.600 1.4e-02
pancreatic cancer 1.200 6.4e-06
primary pancreatic ductal adenocarcinoma 1.114 3.8e-02

Protein-protein Interaction (1)

Gene RIF (80)

AA Sequence

MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLD      1 - 70
YLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDE     71 - 140
SNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGAPPLPPDLQLE    141 - 210
EEGTCANSSEMFLPLRSRTVSRQ                                                   211 - 233
//

Text Mined References (148)

PMID Year Title