Property Summary

NCBI Gene PubMed Count 132
Grant Count 4
R01 Count 4
Funding $286,785.72
PubMed Score 4.24
PubTator Score 303.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession O95999 Q5VUF1
Symbols CLAP
mE10
CIPER
IMD37
c-E10
CARMEN

Gene

PDB

2MB9  

Gene RIF (78)

PMID Text
26774590 BCL10 is not essential for actin polymerization after fibroblast FcgammaR stimulation.
26771713 BCL10 promoted DNA double-strand breaks repair, enhancing cell survival after DNA damage.
26668357 Data show that caspase recruitment domain-containing protein 11/B-cell CLL/lymphoma 10/mucosa-associated lymphoid tissue lymphoma translocation gene 1 signaling drives lymphoproliferation through NF-kappa B and c-Jun N-terminal kinase activation.
26038114 we identified BCL10 as a bona fide target of BCR-induced linear ubiquitylation and demonstrated an important role of the linear ubiquitin ligase HOIP in BCR-induced phosphorylation
25849213 characterization of zebrafish (Danio rerio) Bcl10
25384343 Overexpression of CARMA-BCL10-MALT in T-ALL may contribute to the constitutive cleavage and inactivation of A20, which enhances NF-kappaB signaling and may be related to T-ALL pathogenesis.
25365219 The results of this study indicate that inherited BCL10 deficiency should be considered in patients with combined immunodeficiency with B cell, T cell, and fibroblast defects.
25105596 BCL10 induces cleavage of MALT1 at R149 in 293T cells.
24732096 BCL10 delivers UBC13 to RNF8/RNF168 to regulate ubiquitination-mediated double-strand break signaling and repair.
24702227 elevated in cholesteatoma
More...

AA Sequence

MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLD      1 - 70
YLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDE     71 - 140
SNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGAPPLPPDLQLE    141 - 210
EEGTCANSSEMFLPLRSRTVSRQ                                                   211 - 233
//

Publication (139)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27070702 2016 Targeting Non-proteolytic Protein Ubiquitination for the Treatment of Diffuse Large B Cell Lymphoma.
26774590 2016 Actin polymerisation after FC?R stimulation of human fibroblasts is BCL10 independent.
26771713 2016 BCL10 is recruited to sites of DNA damage to facilitate DNA double-strand break repair.
26668357 2015 Lymphomagenic CARD11/BCL10/MALT1 signaling drives malignant B-cell proliferation via cooperative NF-?B and JNK activation.
26038114 2015 Systems-wide analysis of BCR signalosomes and downstream phosphorylation and ubiquitylation.
25849213 2015 Functional characterization of zebrafish (Danio rerio) Bcl10.
25416956 2014 A proteome-scale map of the human interactome network.
25384343 2014 Characteristics of CARMA1-BCL10-MALT1-A20-NF-?B expression in T cell-acute lymphocytic leukemia.
25365219 2014 Inherited BCL10 deficiency impairs hematopoietic and nonhematopoietic immunity.
More...