Property Summary

NCBI Gene PubMed Count 54
PubMed Score 101.63
PubTator Score 69.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.600 5.7e-04
Astrocytoma, Pilocytic 2.100 4.2e-08
chronic rhinosinusitis 1.004 3.8e-02
glioblastoma 1.100 1.2e-05
head and neck cancer and chronic obstruc... 1.300 5.2e-03
interstitial cystitis 2.100 4.3e-04
osteosarcoma -1.112 1.6e-06
posterior fossa group A ependymoma 1.300 1.7e-04
psoriasis -2.000 1.3e-04
ulcerative colitis 1.200 2.9e-04

Gene RIF (41)

AA Sequence

MTMRHNWTPDLSPLWVLLLCAHVVTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVT      1 - 70
WPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLT     71 - 140
PALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG                    141 - 194
//

Text Mined References (56)

PMID Year Title