Property Summary

NCBI Gene PubMed Count 48
Grant Count 38
R01 Count 27
Funding $2,803,178.2
PubMed Score 97.43
PubTator Score 69.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -2.000 0.000
osteosarcoma -1.112 0.000
glioblastoma 1.100 0.000
interstitial cystitis 2.100 0.000
adult high grade glioma 1.600 0.001
pilocytic astrocytoma 2.100 0.000
posterior fossa group A ependymoma 1.300 0.000
ulcerative colitis 1.200 0.000
chronic rhinosinusitis 1.004 0.038
head and neck cancer and chronic obstruc... 1.300 0.005

Gene RIF (35)

PMID Text
25807634 imbalance of IL-18/IL-18BP ratio in IgA nephropathy especially in patients with arteriolar lesions
25548255 The natural IL-18 inhibitor IL-18BP further regulates IL-18 activity in the extracellular environment. Review.
24963217 IL-18, IL-18BP, and IL-18R may have roles in the pathogenesis of epithelial ovarian carcinoma
24478434 HPV16 E7 oncoprotein increases production of the IL18BP in keratinocytes.
23873689 these data indicate that IL-18BP, which is produced in EOC in response to microenvironmental factors, may inhibit endogenous or exogenous IL-18 activity
23419721 Data suggest that the imbalance of IL-18/IL-18BP might play an important role in the pathogenesis of systemic juvenile idiopathic arthritis (SJIA) and it might go hand-in-hand with the severity of SJIA.
22913567 Due to highly significant increases in circulating IL-18BP in schizophrenia compared to controls, the levels of free IL-18 are not significantly different between schizophrenic groups.
22289535 The balance between interleukin-18 (IL-18) and its endogenous antagonist, IL-18 binding protein (IL-18BP), was evaluated in children with Henoch-Schonlein purpura.
21867627 Imbalance between IL-18 and IL-18BP may play an important role in pathogenesis of idiopathic thrombocytopenic purpura.
21656327 High IL-18 BP levels indicate the severity of existing glomerular injury in systemic lupus erythematosus.
More...

AA Sequence

MTMRHNWTPDLSPLWVLLLCAHVVTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVT      1 - 70
WPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLT     71 - 140
PALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG                    141 - 194
//

Text Mined References (50)

PMID Year Title
25807634 2015 Imbalance of interleukin-18 and interleukin-18 binding protein in patients with IgA nephropathy implicating renal vasculopathy.
25548255 2015 Context-dependent role of IL-18 in cancer biology and counter-regulation by IL-18BP.
24963217 2014 Expression of IL-18, IL-18 binding protein, and IL-18 receptor by normal and cancerous human ovarian tissues: possible implication of IL-18 in the pathogenesis of ovarian carcinoma.
24478434 2014 Human papillomavirus E7 oncoprotein increases production of the anti-inflammatory interleukin-18 binding protein in keratinocytes.
23873689 2013 The IL-18 antagonist IL-18-binding protein is produced in the human ovarian cancer microenvironment.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23419721 2013 The imbalance of IL-18/IL-18BP in patients with systemic juvenile idiopathic arthritis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22913567 2012 Elevated levels of circulating IL-18BP and perturbed regulation of IL-18 in schizophrenia.
22289535 2011 Imbalance of interleukin-18 and interleukin-18 binding protein in children with Henoch-Schönlein purpura.
More...