Property Summary

NCBI Gene PubMed Count 176
Grant Count 147
R01 Count 109
Funding $13,101,350.7
PubMed Score 244.32
PubTator Score 316.26

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95997
Symbols EAP1
PTTG
HPTTG
TUTR1

Gene

 GWAS Trait (1)

Gene RIF (153)

PMID Text
26900962 knockdown of PTTG1 increased expression of integrin alpha 4 (ITGA4), ITGA5, and integrin beta 1 (ITGB1); otherwise, RhoA expression was significantly decreased
26824458 Pttg1 may increase BC cell growth through nuclear exclusion of p27, which highlights a novel molecular regulatory machinery in tumorigenesis of BC.
26710612 PTTG1 enhances HBV replication through suppression of P53.
26516926 Data show that overexpression of c-myc proto-oncogene protein could prevent the metabolic shift induced by pituitary tumor-transforming gene (PTTG) knockwown.
26445238 Data show that pituitary tumor-transforming 1 protein (PTTG1) is over-expressed in multiple myeloma (MM) patients and is associated with poor survival.
26320179 Report feedback loop between PTTG1 targeting miRNAs, PTTG1 and p53 that promotes pituitary tumorigenesis.
26264222 FoxM1 binds to PTTG1 promoter to enhance PTTG1 transcription, and FoxM1-PTTG1 pathway promotes colorectal cancer migration and invasion
25908389 Silencing of PTTG could also inhibit tumor growth, invasion, and angiogenesis in vivo. Our data indicated that PTTG might be a potential target for glioma treatment
25877755 our data suggest that Pttg1 may increase CC cell metastasis, which is negatively regulated by miR-494
25874498 we demonstrated here the inhibitory effect of CACP on the growth of H22 cells in vitro and in vivo, which may be through, at least partly, repression of PTTG1 and then followed by the inactivation of P13/Akt and activation of p38 MARK signaling pathways
More...

AA Sequence

MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFDAPPALPKATRKALGTVNRA      1 - 70
TEKSVKTKGPLKQKQPSFSAKKMTEKTVKAKSSVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLP     71 - 140
LSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI            141 - 202
//

Publication (178)

PMID Year Title
26900962 2016 Alteration of Pituitary Tumor Transforming Gene-1 Regulates Trophoblast Invasion via the Integrin/Rho-Family Signaling Pathway.
26824458 2016 Pttg1 Promotes Growth of Breast Cancer through P27 Nuclear Exclusion.
26710612 2015 [PTTG1 enhances Hepatitis B Virus replication through P53].
26516926 2015 PTTG regulates the metabolic switch of ovarian cancer cells via the c-myc pathway.
26445238 2015 PTTG1 expression is associated with hyperproliferative disease and poor prognosis in multiple myeloma.
26320179 2015 The PTTG1-targeting miRNAs miR-329, miR-300, miR-381, and miR-655 inhibit pituitary tumor cell tumorigenesis and are involved in a p53/PTTG1 regulation feedback loop.
26264222 2015 FoxM1 transactivates PTTG1 and promotes colorectal cancer cell migration and invasion.
25908389 2015 Pituitary tumor transforming gene: a novel therapeutic target for glioma treatment.
25877755 2015 MiRNA-494 inhibits metastasis of cervical cancer through Pttg1.
25874498 2015 A Aconitum coreanum polysaccharide fraction induces apoptosis of hepatocellular carcinoma (HCC) cells via pituitary tumor transforming gene 1 (PTTG1)-mediated suppression of the P13K/Akt and activation of p38 MAPK signaling pathway and displays antitumor activity in vivo.
More...