Property Summary

NCBI Gene PubMed Count 176
PubMed Score 244.32
PubTator Score 316.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung cancer 2798 1.38313420587413E-26
lung adenocarcinoma 2714 9.36676464665888E-10
Breast cancer 3099 3.57098549433875E-9
ovarian cancer 8492 5.96286035713533E-9
adrenocortical carcinoma 1427 3.67073488615011E-7
breast carcinoma 1614 8.1699738725755E-7
atypical teratoid/rhabdoid tumor 1095 1.49727374351935E-6
lung cancer 4473 5.94104131685952E-6
pancreatic cancer 2300 5.73807772028294E-5
Atopic dermatitis 944 5.79169194733498E-5
group 3 medulloblastoma 2254 6.5894409416655E-5
invasive ductal carcinoma 2950 1.64987887225688E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.790904331431E-4
pediatric high grade glioma 2712 2.40327779901963E-4
medulloblastoma, large-cell 6234 3.95649222855167E-4
primitive neuroectodermal tumor 3031 4.01882765447031E-4
colon cancer 1475 7.09903714918254E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0010489241057811
ductal carcinoma in situ 1745 0.00152617036091699
glioblastoma 5572 0.00591473712377973
primary Sjogren syndrome 789 0.011118765518843
Endometriosis 535 0.0146322841931228
osteosarcoma 7933 0.0477240847073498
Disease Target Count Z-score Confidence
systemic lupus erythematosus 172 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 4.299 2.1
Disease Target Count Z-score Confidence
Adenoma 165 3.738 1.9
Pituitary adenoma 35 3.564 1.8

Expression

Synonym

Accession O95997
Symbols EAP1
PTTG
HPTTG
TUTR1

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG
Rat OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG

 GWAS Trait (1)

Gene RIF (153)

PMID Text
26900962 knockdown of PTTG1 increased expression of integrin alpha 4 (ITGA4), ITGA5, and integrin beta 1 (ITGB1); otherwise, RhoA expression was significantly decreased
26824458 Pttg1 may increase BC cell growth through nuclear exclusion of p27, which highlights a novel molecular regulatory machinery in tumorigenesis of BC.
26710612 PTTG1 enhances HBV replication through suppression of P53.
26516926 Data show that overexpression of c-myc proto-oncogene protein could prevent the metabolic shift induced by pituitary tumor-transforming gene (PTTG) knockwown.
26445238 Data show that pituitary tumor-transforming 1 protein (PTTG1) is over-expressed in multiple myeloma (MM) patients and is associated with poor survival.
26320179 Report feedback loop between PTTG1 targeting miRNAs, PTTG1 and p53 that promotes pituitary tumorigenesis.
26264222 FoxM1 binds to PTTG1 promoter to enhance PTTG1 transcription, and FoxM1-PTTG1 pathway promotes colorectal cancer migration and invasion
25908389 Silencing of PTTG could also inhibit tumor growth, invasion, and angiogenesis in vivo. Our data indicated that PTTG might be a potential target for glioma treatment
25877755 our data suggest that Pttg1 may increase CC cell metastasis, which is negatively regulated by miR-494
25874498 we demonstrated here the inhibitory effect of CACP on the growth of H22 cells in vitro and in vivo, which may be through, at least partly, repression of PTTG1 and then followed by the inactivation of P13/Akt and activation of p38 MARK signaling pathways
More...

AA Sequence

MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFDAPPALPKATRKALGTVNRA      1 - 70
TEKSVKTKGPLKQKQPSFSAKKMTEKTVKAKSSVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLP     71 - 140
LSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI            141 - 202
//

Text Mined References (178)

PMID Year Title
26900962 2016 Alteration of Pituitary Tumor Transforming Gene-1 Regulates Trophoblast Invasion via the Integrin/Rho-Family Signaling Pathway.
26824458 2016 Pttg1 Promotes Growth of Breast Cancer through P27 Nuclear Exclusion.
26710612 2015 [PTTG1 enhances Hepatitis B Virus replication through P53].
26516926 2015 PTTG regulates the metabolic switch of ovarian cancer cells via the c-myc pathway.
26445238 2015 PTTG1 expression is associated with hyperproliferative disease and poor prognosis in multiple myeloma.
26320179 2015 The PTTG1-targeting miRNAs miR-329, miR-300, miR-381, and miR-655 inhibit pituitary tumor cell tumorigenesis and are involved in a p53/PTTG1 regulation feedback loop.
26264222 2015 FoxM1 transactivates PTTG1 and promotes colorectal cancer cell migration and invasion.
25908389 2015 Pituitary tumor transforming gene: a novel therapeutic target for glioma treatment.
25877755 2015 MiRNA-494 inhibits metastasis of cervical cancer through Pttg1.
25874498 2015 A Aconitum coreanum polysaccharide fraction induces apoptosis of hepatocellular carcinoma (HCC) cells via pituitary tumor transforming gene 1 (PTTG1)-mediated suppression of the P13K/Akt and activation of p38 MAPK signaling pathway and displays antitumor activity in vivo.
More...