Property Summary

NCBI Gene PubMed Count 185
PubMed Score 261.44
PubTator Score 316.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
psoriasis 1.100 1.4e-06
adrenocortical carcinoma 2.830 3.7e-07
adult high grade glioma 1.200 3.9e-03
Atopic dermatitis 1.600 5.8e-05
atypical teratoid / rhabdoid tumor 1.400 3.1e-04
Breast cancer 2.200 3.5e-15
breast carcinoma 2.400 8.2e-07
colon cancer 1.300 7.1e-04
ductal carcinoma in situ 2.100 1.5e-03
Endometriosis 1.449 1.5e-02
glioblastoma 1.700 4.4e-07
group 3 medulloblastoma 2.100 6.6e-05
intraductal papillary-mucinous carcinoma... 2.700 1.8e-04
intraductal papillary-mucinous neoplasm ... 3.100 1.0e-03
invasive ductal carcinoma 2.300 1.6e-04
lung adenocarcinoma 2.100 9.4e-10
lung cancer 3.500 2.5e-05
medulloblastoma, large-cell 1.700 4.0e-04
non-small cell lung cancer 2.487 1.4e-26
osteosarcoma -1.835 4.8e-02
ovarian cancer 2.200 6.0e-09
pancreatic cancer 1.300 5.7e-05
primary Sjogren syndrome 1.200 1.1e-02
primitive neuroectodermal tumor 1.800 4.0e-04

Protein-protein Interaction (3)

Gene RIF (162)

AA Sequence

MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFDAPPALPKATRKALGTVNRA      1 - 70
TEKSVKTKGPLKQKQPSFSAKKMTEKTVKAKSSVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLP     71 - 140
LSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI            141 - 202
//

Text Mined References (187)

PMID Year Title