Property Summary

NCBI Gene PubMed Count 92
Grant Count 38
R01 Count 21
Funding $4,313,546.22
PubMed Score 125.75
PubTator Score 246.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (73)

PMID Text
26876500 These data together identify the single cysteine of AGR2 as an oxidant responsive moiety that regulates its propensity for oxidation and its monomeric-dimeric state.
26445321 Nearly all NSCLC tumors show AGR2 expression. Lung cancer expression of AGR2 has prognostic value for younger patients.
26169982 Results show that AGR2 is O-glycosylated upon secretion from human and rat cell lines, and that this form of the protein is released from healthy cells and not as a result of cell lysis.
26079208 Our findings, for the first time, describe AGR2 as an important regulator in chemical hypoxia-induced doxorubicin resistance in breast cancer cells
25956506 The mechanism linking the IGF-1/insulin signal and AGR2 promoter activation is important.
25937245 analysis of molecular characteristics, function, and regulation of AGR2 in cancer[review]
25875093 Data show the potential usability of anterior gradient homolog 3 (AGR3) and anterior gradient homolog 2 (AGR2) as biomarkers for blood-based early detection of breast cancer.
25871396 AGR2 was higher in HNSCC than in normal oral mucosa. High levels were associated with the T category, pathological grade and lymphatic metastasis. AGR2 expression increased in recurring HNSCC after radiotherapy or cisplatin-based chemotherapy.
25666661 Relying on available data and in silico analyses, study shows that AGR2 and AGR3 proteins are co-expressed or uncoupled in context-dependent manners in diverse carcinomas and healthy tissues.
25663596 The prognostic impact of AGR2 expression could be related to treatment outcome in estrogen receptor-positive breast cancers and/or its metastasis-promoting effects.
More...

AA Sequence

MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNK      1 - 70
PLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRAD     71 - 140
ITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL                                       141 - 175
//

Publication (93)

PMID Year Title
26876500 2016 Mass spectrometry analysis of the oxidation states of the pro-oncogenic protein anterior gradient-2 reveals covalent dimerization via an intermolecular disulphide bond.
26445321 2015 High expression of AGR2 in lung cancer is predictive of poor survival.
26169982 2015 The metastasis-inducing protein AGR2 is O-glycosylated upon secretion from mammary epithelial cells.
26079208 2015 Anterior gradient 2 is a binding stabilizer of hypoxia inducible factor-1? that enhances CoCl2 -induced doxorubicin resistance in breast cancer cells.
25956506 2015 Induction of anterior gradient 2 (AGR2) plays a key role in insulin-like growth factor-1 (IGF-1)-induced breast cancer cell proliferation and migration.
25937245 2015 Mechanisms of anterior gradient-2 regulation and function in cancer.
25875093 2015 AGR3 in breast cancer: prognostic impact and suitable serum-based biomarker for early cancer detection.
25871396 2015 Anterior gradient protein 2 expression in high grade head and neck squamous cell carcinoma correlated with cancer stem cell and epithelial mesenchymal transition.
25666661 The role of AGR2 and AGR3 in cancer: similar but not identical.
25666625 2015 Epidermal growth factor receptor (EGFR) signaling requires a specific endoplasmic reticulum thioredoxin for the post-translational control of receptor presentation to the cell surface.
More...