Property Summary

NCBI Gene PubMed Count 108
PubMed Score 136.60
PubTator Score 246.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.504 2.6e-03
active ulcerative colitis 1.207 3.5e-02
Barrett's esophagus 4.400 2.7e-02
breast carcinoma 1.200 2.4e-04
colon cancer -1.200 2.2e-02
esophageal adenocarcinoma 4.900 1.8e-02
interstitial cystitis -3.300 3.0e-03
intraductal papillary-mucinous adenoma (... 3.200 1.2e-03
intraductal papillary-mucinous carcinoma... 3.200 2.1e-03
intraductal papillary-mucinous neoplasm ... 3.200 1.5e-02
invasive ductal carcinoma 5.300 1.5e-03
lung adenocarcinoma 1.700 6.6e-07
lung cancer -2.700 4.4e-04
lung carcinoma -2.400 2.3e-11
nasopharyngeal carcinoma -1.900 2.1e-03
pancreatic cancer 3.400 3.0e-08
pancreatic ductal adenocarcinoma liver m... 1.888 1.1e-03
pituitary cancer -3.700 4.1e-04
psoriasis -1.400 3.0e-26
spina bifida -1.827 3.7e-02

Synonym

Accession O95994 AG-2
Symbols AG2
AG-2
HPC8
GOB-4
HAG-2
XAG-2
PDIA17
HEL-S-116

Gene

PANTHER Protein Class (2)

PDB

2LNS   2LNT  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (87)

AA Sequence

MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNK      1 - 70
PLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRAD     71 - 140
ITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL                                       141 - 175
//

Text Mined References (109)

PMID Year Title