Property Summary

NCBI Gene PubMed Count 21
PubMed Score 38.18
PubTator Score 16.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma -1.305 8.7e-05
aldosterone-producing adenoma -1.366 3.2e-02
astrocytoma 2.200 3.3e-02
Astrocytoma, Pilocytic 2.200 2.0e-06
Atopic dermatitis 1.500 7.0e-04
chronic rhinosinusitis -1.464 3.1e-02
cutaneous lupus erythematosus 1.900 3.5e-04
cystic fibrosis 2.500 9.6e-04
ductal carcinoma in situ 1.300 3.4e-02
ependymoma 1.200 1.5e-02
group 3 medulloblastoma -1.500 9.7e-03
inflammatory breast cancer -1.800 4.1e-04
intraductal papillary-mucinous carcinoma... -3.100 3.1e-03
intraductal papillary-mucinous neoplasm ... -3.300 8.3e-03
lung cancer -3.500 6.8e-06
lung carcinoma -1.200 1.8e-04
malignant mesothelioma 1.300 1.1e-06
nasopharyngeal carcinoma -1.800 1.7e-05
non-small cell lung cancer -1.656 8.0e-10
oligodendroglioma -1.200 1.0e-04
pancreatic cancer 1.200 7.5e-03
pituitary cancer -1.700 6.0e-04
primary pancreatic ductal adenocarcinoma 1.175 3.7e-03
primary Sjogren syndrome 1.100 2.9e-04
psoriasis 1.100 2.6e-23
tuberculosis and treatment for 3 months -1.500 1.0e-03
ulcerative colitis 1.100 1.5e-03

 GWAS Trait (1)

Gene RIF (18)

AA Sequence

MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDILCSWVPALRR      1 - 70
YKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPELLLLLHHILFCLLLFDMEFF     71 - 140
VWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWL    141 - 210
SVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR            211 - 272
//

Text Mined References (22)

PMID Year Title