Property Summary

NCBI Gene PubMed Count 20
Grant Count 2
R01 Count 1
Funding $154,251
PubMed Score 31.14
PubTator Score 16.58

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95992 B2RBY3
Symbols C25H

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Gene RIF (17)

PMID Text
26857497 Exome analysis in 212 multiple sclerosis and 14 neuromyelitis optica patients identified a rare CH25H p.Q17H mutation in two NMO patients of Asian ancestry. In addition, association analysis of common CH25H variants.
26469385 HIV-1 MA increases CH25H mRNA expression in HepG2 cells
25999047 Infection with HCV causes up-regulation of interferon-inducible CH25H in vivo.
25903345 These results demonstrate that CH25H constitutes a primary innate response against hepatitis C virus infection through regulating host lipid metabolism.
24667918 HIV-1 MA increases CH25H mRNA expression in HepG2 cells
20699362 Cholesterol 25-hydroxylase production by dendritic cells and macrophages is regulated by type I interferons.
20574532 Observational study of gene-disease association. (HuGE Navigator)
20535486 Observational study of gene-disease association. (HuGE Navigator)
20534741 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20413850 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDILCSWVPALRR      1 - 70
YKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPELLLLLHHILFCLLLFDMEFF     71 - 140
VWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWL    141 - 210
SVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR            211 - 272
//

Publication (21)

PMID Year Title
26857497 2016 Analysis of CH25H in multiple sclerosis and neuromyelitis optica.
25999047 2015 Interferon-inducible cholesterol-25-hydroxylase restricts hepatitis C virus replication through blockage of membranous web formation.
25903345 2015 Identification of Cholesterol 25-Hydroxylase as a Novel Host Restriction Factor and a Part of the Primary Innate Immune Responses against Hepatitis C Virus Infection.
21041692 2010 Identification of genomic predictors of atrioventricular conduction: using electronic medical records as a tool for genome science.
20699362 2010 Cholesterol 25-hydroxylase production by dendritic cells and macrophages is regulated by type I interferons.
20574532 2010 Intermediate phenotypes identify divergent pathways to Alzheimer's disease.
20535486 2010 Capillary cerebral amyloid angiopathy identifies a distinct APOE epsilon4-associated subtype of sporadic Alzheimer's disease.
20534741 2010 Association of CR1, CLU and PICALM with Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
20445134 2010 Association of genome-wide variation with the risk of incident heart failure in adults of European and African ancestry: a prospective meta-analysis from the cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium.
20413850 2010 Systematic analysis of candidate genes for Alzheimer's disease in a French, genome-wide association study.
More...