Property Summary

NCBI Gene PubMed Count 28
PubMed Score 15.76
PubTator Score 17.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
psoriasis -1.100 0.000
ependymoma -1.200 0.002
glioblastoma -2.600 0.001
sonic hedgehog group medulloblastoma -4.300 0.000
atypical teratoid / rhabdoid tumor -1.800 0.003
medulloblastoma, large-cell -4.600 0.000
primitive neuroectodermal tumor -2.400 0.004
non-small cell lung cancer -4.948 0.000
intraductal papillary-mucinous adenoma (... -1.500 0.001
intraductal papillary-mucinous carcinoma... -1.600 0.001
intraductal papillary-mucinous neoplasm ... -1.600 0.008
lung cancer -5.300 0.000
colon cancer -2.300 0.000
pancreatic cancer -1.200 0.000
breast carcinoma -2.000 0.000
fibroadenoma -1.600 0.006
Breast cancer -2.300 0.039
lung adenocarcinoma -4.300 0.000
pediatric high grade glioma -2.700 0.000
pilocytic astrocytoma -1.700 0.000
Endometriosis -1.362 0.034
lung carcinoma -1.700 0.000
ductal carcinoma in situ -2.300 0.000
invasive ductal carcinoma -3.000 0.000
ovarian cancer 1.700 0.002
pituitary cancer -2.200 0.003
Down syndrome 1.400 0.001
chronic rhinosinusitis -1.452 0.048

Gene RIF (5)

PMID Text
25753555 Importance of FAM107A in lung carcinogenesis, although other than promoter hypermethylation mechanism of the gene decreased expression.
24141773 Results found that DRR expression leads to elevated AKT activation by recruiting AKT to focal adhesios in a manner dependent on SRC-family kinases (SFKs) and cell adhesion.
20298674 DRR1 protein is expressed in normal cells, particularly in the nervous system during embryogenesis, is involved in neuronal cell survival, and is downregulated during neuroblastoma carcinogenesis.
18813805 TU3A is epigenetically inactivated in human cancer
16432833 Expression of the down-regulated in renal cell carcinoma gene (DRR1) gene at 3p14.2 was lost in 7 and down regulated in 2 "chr3+" tumours.

AA Sequence

MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRV      1 - 70
LEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE     71 - 140
EREL                                                                      141 - 144
//

Text Mined References (29)

PMID Year Title
25753555 2015 Decreased FAM107A Expression in Patients with Non-small Cell Lung Cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24141773 2014 DRR regulates AKT activation to drive brain cancer invasion.
22825356 2012 Loss of HITS (FAM107B) expression in cancers of multiple organs: tissue microarray analysis.
20709424 2010 Native type IV collagen induces cell migration through a CD9 and DDR1-dependent pathway in MDA-MB-231 breast cancer cells.
20453842 2010 Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci.
20298674 2010 DRR1 is expressed in the developing nervous system and downregulated during neuroblastoma carcinogenesis.
19787223 2009 Induction of tumor inhibition and apoptosis by a candidate tumor suppressor gene DRR1 on 3p21.1.
18813805 2008 Methylation-associated silencing of TU3A in human cancers.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...