Property Summary

NCBI Gene PubMed Count 17
PubMed Score 99.25
PubTator Score 30.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 2.01312658538766E-7
atypical teratoid / rhabdoid tumor 4369 9.80780038292404E-7
osteosarcoma 7933 4.71056777794969E-6
medulloblastoma, large-cell 6234 5.7632095756133E-6
adult high grade glioma 2148 6.44667818056555E-6
glioblastoma 5572 3.36433697848032E-5
ovarian cancer 8492 1.00427615388833E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00571469991851026
Rheumatoid Arthritis 1171 0.0112366681166421
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0222558274911584
lung cancer 4473 0.0229088430755264
invasive ductal carcinoma 2950 0.024689578346182
Breast cancer 3099 0.0346689193861353
subependymal giant cell astrocytoma 2287 0.0447583595791377
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Disease Target Count Z-score Confidence
Mucoepidermoid carcinoma 19 3.104 1.6

Expression

Synonym

Accession O95989 B2R8N4 DIPP-1
Symbols DIPP
DIPP1
DIPP-1

Gene

PANTHER Protein Class (2)

PDB

2FVV   2Q9P  

  Ortholog (7)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (3)

PMID Text
26932476 Nudt3 is an mRNA decapping enzyme that orchestrates expression of a subset of mRNAs to modulate cell migration and further substantiates the existence of multiple decapping enzymes functioning in distinct cellular pathways in mammals
23708086 results suggest that NUDT3 rs206936 is associated with body mass index in Japanese women
18854154 Knockdown of nudix (nucleoside diphosphate linked moiety X)-type motif 3 (NUDT3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEE      1 - 70
AGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYF     71 - 140
ETLRQGYSANNGTPVVATTYSVSAQSSMSGIR                                          141 - 172
//

Text Mined References (20)

PMID Year Title
26932476 2016 Nudt3 is an mRNA decapping enzyme that modulates cell migration.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
23708086 2013 NUDT3 rs206936 is associated with body mass index in obese Japanese women.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
19585659 2009 Crystal structure of human diphosphoinositol phosphatase 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...