Property Summary

NCBI Gene PubMed Count 10
PubMed Score 16.77
PubTator Score 9.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Gene RIF (2)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)
20228224 subcellular localization of activated AKT is dependent on TCL1B expression in estrogen receptor- and progesterone receptor-expressing breast cancer

AA Sequence

MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHT      1 - 70
RELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPERKD                 71 - 128
//

Text Mined References (12)

PMID Year Title
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20228224 2010 Subcellular localization of activated AKT in estrogen receptor- and progesterone receptor-expressing breast cancers: potential clinical implications.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707444 2002 Differential regulation of Akt kinase isoforms by the members of the TCL1 oncogene family.
11607815 2001 The role of TCL1 in human T-cell leukemia.
10983986 2000 The protooncogene TCL1 is an Akt kinase coactivator.
10851082 2000 Identification of the TCL6 genes within the breakpoint cluster region on chromosome 14q32 in T-cell leukemia.
More...