Property Summary

NCBI Gene PubMed Count 10
PubMed Score 16.34
PubTator Score 9.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Strongyloidiasis 9 3.338 1.7
Leukemia 104 3.146 1.6

Synonym

Accession O95988 A6NEK7 Q6IAR7 Q9UBQ4
Symbols TML1
SYN-1

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (2)

AA Sequence

MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHT      1 - 70
RELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPERKD                 71 - 128
//

Text Mined References (12)

PMID Year Title