Property Summary

NCBI Gene PubMed Count 19
Grant Count 12
R01 Count 9
Funding $1,339,386.63
PubMed Score 9.38
PubTator Score 10.04

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
24507716 TOP3B promotes transcription, protects against DNA damage, and reduces the frequency of chromosomal translocations.
20950730 Topoisomerase IIIbeta expression can be a useful marker in assessing the prognosis of patients with breast cancer and is an independent predictor of survival.
18854154 Knockdown of topoisomerase (DNA) III beta (TOP3B) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
15358519 the positive regulatory region including the 5'GGAACC3' core element is essential for efficient expression of the DNA topoisomerase III beta gene
11549288 Two isoforms of human DNA topoisomerase IIIbeta were expressed in HeLa cells. Isoform 1 was localized to the nucleus and associated with chromosomes during metaphase and anaphase. Isoform 2 was found in the cytoplasm.

AA Sequence

MKTVLMVAEKPSLAQSIAKILSRGSLSSHKGLNGACSVHEYTGTFAGQPVRFKMTSVCGHVMTLDFLGKY      1 - 70
NKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYIVLWLDCDKEGENICFEVLDAVLPVMNKA     71 - 140
HGGEKTVFRARFSSITDTDICNAMACLGEPDHNEALSVDARQELDLRIGCAFTRFQTKYFQGKYGDLDSS    141 - 210
LISFGPCQTPTLGFCVERHDKIQSFKPETYWVLQAKVNTDKDRSLLLDWDRVRVFDREIAQMFLNMTKLE    211 - 280
KEAQVEATSRKEKAKQRPLALNTVEMLRVASSSLGMGPQHAMQTAERLYTQGYISYPRTETTHYPENFDL    281 - 350
KGSLRQQANHPYWADTVKRLLAEGINRPRKGHDAGDHPPITPMKSATEAELGGDAWRLYEYITRHFIATV    351 - 420
SHDCKYLQSTISFRIGPELFTCSGKTVLSPGFTEVMPWQSVPLEESLPTCQRGDAFPVGEVKMLEKQTNP    421 - 490
PDYLTEAELITLMEKHGIGTDASIPVHINNICQRNYVTVESGRRLKPTNLGIVLVHGYYKIDAELVLPTI    491 - 560
RSAVEKQLNLIAQGKADYRQVLGHTLDVFKRKFHYFVDSIAGMDELMEVSFSPLAATGKPLSRCGKCHRF    561 - 630
MKYIQAKPSRLHCSHCDETYTLPQNGTIKLYKELRCPLDDFELVLWSSGSRGKSYPLCPYCYNHPPFRDM    631 - 700
KKGMGCNECTHPSCQHSLSMLGIGQCVECESGVLVLDPTSGPKWKVACNKCNVVAHCFENAHRVRVSADT    701 - 770
CSVCEAALLDVDFNKAKSPLPGDETQHMGCVFCDPVFQELVELKHAASCHPMHRGGPGRRQGRGRGRARR    771 - 840
PPGKPNPRRPKDKMSALAAYFV                                                    841 - 862
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24507716 2014 Arginine methylation facilitates the recruitment of TOP3B to chromatin to prevent R loop accumulation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20950730 2010 Significance of topoisomerase III? expression in breast ductal carcinomas: strong associations with disease-specific survival and metastasis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15358519 2004 Identification of the functional elements in the promoter region of human DNA topoisomerase IIIbeta gene.
More...