Property Summary

NCBI Gene PubMed Count 50
PubMed Score 7.92
PubTator Score 41.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Autistic Disorder 364 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.8e-10
osteosarcoma 7950 2.5e-06
psoriasis 6694 2.7e-04

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.649 2.5e-06
ovarian cancer 1.500 2.8e-10
psoriasis 1.400 2.7e-04

Gene RIF (18)

AA Sequence

MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKML      1 - 70
MSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWE     71 - 140
KKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNT    141 - 210
TQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEE    211 - 280
EPDPDPEMEHV                                                               281 - 291
//

Text Mined References (60)

PMID Year Title