Property Summary

NCBI Gene PubMed Count 44
Grant Count 18
R01 Count 15
Funding $985,251.85
PubMed Score 7.92
PubTator Score 41.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.200 0.000
osteosarcoma -1.649 0.000
ovarian cancer 1.500 0.000

Gene RIF (16)

PMID Text
25753672 Insufficient MBD3 induced by small interfering RNA (siRNA) was found to result in a global DNA hypermethylation as well as increased methylation in the promoter CpG islands (CGIs) of a number of cell cycle related genes.
24849540 This study investigates the genetic association between methyl-CpG-binding domain (MBD) gene polymorphisms and schizophrenia.
24385926 These data suggest that MBD3, and by extension the NuRD complex, may have multiple roles in fine tuning expression for both active and silent genes, representing an important step in defining regulatory mechanisms
24338710 reduced mRNA expression of MBD2 and MBD3 is implicated in gastric carcinogenesis.
23361464 MBD3 is enriched at active promoters, whereas MBD2 is bound at methylated promoters and enriched at exon sequences of active genes.
23239876 These factors lead to a binding affinity hierarchy of p66alpha for the different MBD2 homologues (MBD2 approximately MBD3 > MBD3L1 approximately MBD3L2).
20004753 MBD3 mutations are not responsible for ICR1 hypomethylation in Silver-Russell syndrome.
19041848 These findings collectively support a role for MBD3 in cell cycle progression and cell death as a modulator of HDAC-mediated transcription.
18644863 Study demonstrates a direct role of the MBD3, a subunit of nucleosome remodeling and deacetylase corepressor complex complex in aberrant gene repression and transmission of epigenetic repressive marks in acute promyelocytic leukemia.
18602768 data demonstrate a causal relationship between MBD3 and DNA demethylation of genomic targets in cells.
More...

AA Sequence

MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKML      1 - 70
MSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWE     71 - 140
KKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNT    141 - 210
TQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEE    211 - 280
EPDPDPEMEHV                                                               281 - 291
//

Text Mined References (53)

PMID Year Title
25753672 2015 Dissecting the behavior and function of MBD3 in DNA methylation homeostasis by single-molecule spectroscopy and microscopy.
25416956 2014 A proteome-scale map of the human interactome network.
25123934 2015 Towards elucidating the stability, dynamics and architecture of the nucleosome remodeling and deacetylase complex by using quantitative interaction proteomics.
24849540 2014 Genetic association study between methyl-CpG-binding domain genes and schizophrenia among Chinese family trios.
24385926 2013 MBD3 localizes at promoters, gene bodies and enhancers of active genes.
24338710 2014 Reduced mRNA expression levels of MBD2 and MBD3 in gastric carcinogenesis.
24307175 2014 Probing the dynamic distribution of bound states for methylcytosine-binding domains on DNA.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23361464 2013 Differential roles for MBD2 and MBD3 at methylated CpG islands, active promoters and binding to exon sequences.
23239876 2013 Unique features of the anti-parallel, heterodimeric coiled-coil interaction between methyl-cytosine binding domain 2 (MBD2) homologues and GATA zinc finger domain containing 2A (GATAD2A/p66?).
More...