Property Summary

NCBI Gene PubMed Count 23
Grant Count 12
R01 Count 4
Funding $1,124,694.34
PubMed Score 53.12
PubTator Score 31.03

Knowledge Summary

Patent (11,503)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.100 0.001
lung adenocarcinoma -1.700 0.000

MLP Assay (24)

AID Type Active / Inconclusive / Inactive Description
1509 screening 771 / 0 / 217346 Primary Cell-Based Assay to Identify Agonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4)
1510 screening 569 / 0 / 217548 Primary Cell-Based Assay to Identify Antagonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4)
1523 screening 53 / 0 / 684 Confirmation cell-based high throughput assay for agonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4)
1524 screening 366 / 0 / 149 Confirmation cell-based high throughput assay for antagonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4)
1686 confirmatory 22 / 0 / 24 Fluorescence dose response cell-based high throughput screening assay for agonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4)
1692 confirmatory 100 / 0 / 0 Fluorescence dose response cell-based high throughput screening assay for antagonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4)
1801 summary 2 / 0 / 0 Summary of probe development efforts to identify agonists of Sphingosine 1-Phosphate Receptor 4 (S1P4)
1853 summary 1 / 0 / 0 Summary of probe development efforts to identify antagonists of Sphingosine 1-Phosphate Receptor 4 (S1P4)
2332 confirmatory 8 / 0 / 21 Late stage fluorescence dose response cell-based screening assay for antagonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4)
2346 confirmatory 16 / 0 / 0 Late stage fluorescence dose response cell-based screening assay for antagonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4): Synthesized analogues
More...

Gene RIF (8)

PMID Text
26783340 Ig-like transcript 7 is rapidly internalized upon receptor-mediated endocytosis of TLR7/9 ligands to allow high IFN-alpha production. This is antagonized by S1PR4 signaling, thus decreasing TLR-induced IFN-alpha secretion.
24486401 S1P2 translocation to the nucleus is regulated by an autocrine loop involving S1P and S1P4. In contrast, the translocation of Y416 phosphorylated c-Src to the nucleus appears to be regulated by a mechanism that does not involve S1P3 or S1P4.
22460268 findings highlight an important role for S1P(4) and SK1 in ER(-) breast cancer progression.
22119461 analysis of novel potent and selective sphingosine-1-phosphate 4 receptor (S1P-R) agonists
20837468 Data show that S1P4 uses HER2 to regulate extracellular signal regulated kinase-1/2 MDA-MB-453 breast cancer cells.
20686109 Data report that sphingosine 1-phosphate receptor 4 (S1P(4)) is specifically up-regulated during the development of human megakaryocytes from progenitor cells
18713968 FOXO1 controls the expression of L-selectin and EDG1 and EDG6, receptors that regulate lymphocyte trafficking
15298705 Mutation of the ligand selectivity residue from glutamic acid to glutamine confers lysophosphatidic acid sensitivity with preference for short-chain species

AA Sequence

MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLVVLENLLVLAA      1 - 70
ITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFLREGLLFTALAASTFSLLFTA     71 - 140
GERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLPLLGWNCLCAFDRCSSLLPLYSKRYILFCLV    141 - 210
IFAGVLATIMGLYGAIFRLVQASGQKAPRPAARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNL    211 - 280
WAQEYLRGMDWILALAVLNSAVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGAST    281 - 350
TDSSLRPRDSFRGSRSLSFRMREPLSSISSVRSI                                        351 - 384
//

Text Mined References (24)

PMID Year Title
26783340 2016 S1PR4 Signaling Attenuates ILT 7 Internalization To Limit IFN-? Production by Human Plasmacytoid Dendritic Cells.
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
24486401 2014 Sphingosine kinase 2 prevents the nuclear translocation of sphingosine 1-phosphate receptor-2 and tyrosine 416 phosphorylated c-Src and increases estrogen receptor negative MDA-MB-231 breast cancer cell growth: The role of sphingosine 1-phosphate receptor-4.
22460268 2012 Expression of sphingosine 1-phosphate receptor 4 and sphingosine kinase 1 is associated with outcome in oestrogen receptor-negative breast cancer.
22119461 2012 Discovery, design and synthesis of novel potent and selective sphingosine-1-phosphate 4 receptor (S1P?-R) agonists.
20837468 2010 Sphingosine 1-phosphate receptor 4 uses HER2 (ERBB2) to regulate extracellular signal regulated kinase-1/2 in MDA-MB-453 breast cancer cells.
20686109 2010 Shaping of terminal megakaryocyte differentiation and proplatelet development by sphingosine-1-phosphate receptor S1P4.
18713968 2008 FOXO1 regulates L-Selectin and a network of human T cell homing molecules downstream of phosphatidylinositol 3-kinase.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
17443712 2007 Peptide design and structural characterization of a GPCR loop mimetic.
More...