Property Summary

NCBI Gene PubMed Count 5
PubMed Score 72.22
PubTator Score 18.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.200 9.6e-03
Astrocytoma, Pilocytic 1.400 2.7e-06
COPD 1.100 3.8e-02
cutaneous lupus erythematosus 2.300 6.4e-03
diabetes mellitus -1.500 1.6e-02
glioblastoma 1.200 2.4e-04
head and neck cancer -1.300 7.9e-03
interstitial cystitis 2.100 1.5e-02
invasive ductal carcinoma 1.325 1.0e-04
lung carcinoma -3.000 1.6e-29
mucosa-associated lymphoid tissue lympho... 2.136 4.9e-02
nasopharyngeal carcinoma 1.100 4.0e-03
non-small cell lung cancer -1.345 8.0e-09
osteosarcoma -1.793 1.9e-02
subependymal giant cell astrocytoma 2.134 2.1e-02
tuberculosis 1.300 7.3e-04
ulcerative colitis 2.400 4.2e-08

Gene RIF (3)

AA Sequence

MGTASRSNIARHLQTNLILFCVGAVGACTLSVTQPWYLEVDYTHEAVTIKCTFSATGCPSEQPTCLWFRY      1 - 70
GAHQPENLCLDGCKSEADKFTVREALKENQVSLTVNRVTSNDSAIYICGIAFPSVPEARAKQTGGGTTLV     71 - 140
VREIKLLSKELRSFLTALVSLLSVYVTGVCVAFILLSKSKSNPLRNKEIKEDSQKKKSARRIFQEIAQEL    141 - 210
YHKRHVETNQQSEKDNNTYENRRVLSNYERP                                           211 - 241
//

Text Mined References (6)

PMID Year Title