Property Summary

NCBI Gene PubMed Count 5
Grant Count 2
Funding $144,333.5
PubMed Score 65.53
PubTator Score 18.95

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
23898208 HIV-1 Tat downregulates the expression of immunoglobulin superfamily, member 6 (IGSF6) in human primary T cells
12786995 Observational study of gene-disease association. (HuGE Navigator)
12786995 There was no evidence for association of the common IGSF6 single nucleotide polymorphisms with disease in a large cohort of patients with inflammatory bowel disease

AA Sequence

MGTASRSNIARHLQTNLILFCVGAVGACTLSVTQPWYLEVDYTHEAVTIKCTFSATGCPSEQPTCLWFRY      1 - 70
GAHQPENLCLDGCKSEADKFTVREALKENQVSLTVNRVTSNDSAIYICGIAFPSVPEARAKQTGGGTTLV     71 - 140
VREIKLLSKELRSFLTALVSLLSVYVTGVCVAFILLSKSKSNPLRNKEIKEDSQKKKSARRIFQEIAQEL    141 - 210
YHKRHVETNQQSEKDNNTYENRRVLSNYERP                                           211 - 241
//

Publication (6)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12786995 2003 Genetic variation in the IGSF6 gene and lack of association with inflammatory bowel disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11132146 2000 The mouse and human IGSF6 (DORA) genes map to the inflammatory bowel disease 1 locus and are embedded in an intron of a gene of unknown function.
9809579 1998 CD40L activation of dendritic cells down-regulates DORA, a novel member of the immunoglobulin superfamily.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.