Property Summary

NCBI Gene PubMed Count 5
PubMed Score 65.53
PubTator Score 18.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Dermatitis, Allergic Contact 66
Disease Target Count P-value
lung carcinoma 2844 1.60168426946401E-29
non-small cell lung cancer 2798 7.99513035539207E-9
ulcerative colitis 2087 4.22011929782009E-8
osteosarcoma 7933 3.06091275366447E-6
pilocytic astrocytoma 3086 7.21673469666895E-6
invasive ductal carcinoma 2950 1.01115216666941E-4
pediatric high grade glioma 2712 1.59155042671964E-4
glioblastoma 5572 2.3645244181318E-4
tuberculosis 1563 7.28485423253599E-4
head and neck cancer and chronic obstructive pulmonary disease 237 0.0034670076973969
nasopharyngeal carcinoma 1056 0.00402078139537632
cutaneous lupus erythematosus 1056 0.00643715257911988
head and neck cancer 270 0.00788414627012663
interstitial cystitis 2299 0.0150022709087478
diabetes mellitus 1663 0.016318809220562
subependymal giant cell astrocytoma 2287 0.0213438504727211
mucosa-associated lymphoid tissue lymphoma 480 0.0489939412671514

Expression

Synonym

Accession O95976 Q8WWD8 IgSF6
Symbols DORA

Gene

  Ortholog (8)

Gene RIF (3)

PMID Text
23898208 HIV-1 Tat downregulates the expression of immunoglobulin superfamily, member 6 (IGSF6) in human primary T cells
12786995 Observational study of gene-disease association. (HuGE Navigator)
12786995 There was no evidence for association of the common IGSF6 single nucleotide polymorphisms with disease in a large cohort of patients with inflammatory bowel disease

AA Sequence

MGTASRSNIARHLQTNLILFCVGAVGACTLSVTQPWYLEVDYTHEAVTIKCTFSATGCPSEQPTCLWFRY      1 - 70
GAHQPENLCLDGCKSEADKFTVREALKENQVSLTVNRVTSNDSAIYICGIAFPSVPEARAKQTGGGTTLV     71 - 140
VREIKLLSKELRSFLTALVSLLSVYVTGVCVAFILLSKSKSNPLRNKEIKEDSQKKKSARRIFQEIAQEL    141 - 210
YHKRHVETNQQSEKDNNTYENRRVLSNYERP                                           211 - 241
//

Text Mined References (6)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12786995 2003 Genetic variation in the IGSF6 gene and lack of association with inflammatory bowel disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11132146 2000 The mouse and human IGSF6 (DORA) genes map to the inflammatory bowel disease 1 locus and are embedded in an intron of a gene of unknown function.
9809579 1998 CD40L activation of dendritic cells down-regulates DORA, a novel member of the immunoglobulin superfamily.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.