Property Summary

NCBI Gene PubMed Count 63
Grant Count 59
R01 Count 31
Funding $5,441,913.11
PubMed Score 198.25
PubTator Score 112.67

Knowledge Summary

Patent

No data available

Synonym

Accession O95972 Q17RM6 Q5JST1 Q9UMS1 BMP-15
Symbols ODG2
POF4
GDF9B

Gene

PANTHER Protein Class (2)

Gene RIF (60)

PMID Text
26254468 results support a model of activation for human GDF9 dependent on cumulin formation through heterodimerization with BMP15. Oocyte-secreted cumulin is likely to be a central regulator of fertility in mono-ovular mammals.
25954833 GDF9 c.169G>T (D57Y), c.546G>A (rs1049127), and BMP15 rs79377927 (788_789insTCT) were associated with premature ovarian failure in the Chinese Hui population.
25721374 BMP15 supplementation differentially modulates reductive metabolism and mitochondrial localization within the oocyte.
25445105 The results showed no direct association between BMP15-9G or 852T and the development of premature ovarian failure (POF). Women with the 538A mutation are up to five times more likely to develop POF. The 788insTCT polymorphism had low biological impact.
25336710 BMP15 polymorphism is not associated with ovarian reserve.
25246117 the BMP15 c.-9G allele is related to BMP15 increased transcription, supporting c.-9C>G as a causal agent of premature ovarian failure
25172094 GDF9 and BMP15 expression is reduced in primordial, primary, and secondary follicles in ovarian tissues of PCOS patients.
25139161 Data suggest upregulation of mRNA for BMP15 and GDF9 (growth differentiation factor 9) in cumulus granulosa cells serves as biomarker for oocyte maturation, fertilization, embryo quality, and pregnancy in couples undergoing ICSI for male infertility.
24980253 BMP15 is a critical regulator of folliculogenesis and granulosa cell activities. Variations in BMP15 gene dosage have a relevant influence on ovarian function and can account for several defects of female fertility.
24413384 Oocyte-derived BMP15 decreases gap junction intercellular communication activity between human granulosa cells by down-regulating Cx43 expression, most likely via a Smad-dependent signaling pathway.
More...

AA Sequence

MVLLSILRILFLCELVLFMEHRAQMAEGGQSSIALLAEAPTLPLIEELLEESPGEQPRKPRLLGHSLRYM      1 - 70
LELYRRSADSHGHPRENRTIGATMVRLVKPLTNVARPHRGTWHIQILGFPLRPNRGLYQLVRATVVYRHH     71 - 140
LQLTRFNLSCHVEPWVQKNPTNHFPSSEGDSSKPSLMSNAWKEMDITQLVQQRFWNNKGHRILRLRFMCQ    141 - 210
QQKDSGGLELWHGTSSLDIAFLLLYFNDTHKSIRKAKFLPRGMEEFMERESLLRRTRQADGISAEVTASS    211 - 280
SKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQ    281 - 350
SVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR                                351 - 392
//

Text Mined References (64)

PMID Year Title
27070094 2016 The Bone Morphogenetic Protein 15 Up-Regulates the Anti-Müllerian Hormone Receptor Expression in Granulosa Cells.
26254468 2015 Cumulin, an Oocyte-secreted Heterodimer of the Transforming Growth Factor-? Family, Is a Potent Activator of Granulosa Cells and Improves Oocyte Quality.
25954833 2015 Single nucleotide polymorphisms in premature ovarian failure-associated genes in a Chinese Hui population.
25721374 2015 Redox and anti-oxidant state within cattle oocytes following in vitro maturation with bone morphogenetic protein 15 and follicle stimulating hormone.
25445105 2014 Gene variation and premature ovarian failure: a meta-analysis.
25336710 2014 A single nucleotide polymorphism of bone morphogenic protein-15 is not associated with ovarian reserve or response to ovarian stimulation.
25246117 2014 BMP15 c.-9C>G promoter sequence variant may contribute to the cause of non-syndromic premature ovarian failure.
25172094 2014 Reduced and delayed expression of GDF9 and BMP15 in ovarian tissues from women with polycystic ovary syndrome.
25139161 2014 Increased GDF9 and BMP15 mRNA levels in cumulus granulosa cells correlate with oocyte maturation, fertilization, and embryo quality in humans.
24980253 The fundamental role of bone morphogenetic protein 15 in ovarian function and its involvement in female fertility disorders.
More...