Property Summary

NCBI Gene PubMed Count 65
PubMed Score 221.69
PubTator Score 112.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

 HCA RNA Cell Line (1)

Protein-protein Interaction (3)

Gene RIF (62)

AA Sequence

MVLLSILRILFLCELVLFMEHRAQMAEGGQSSIALLAEAPTLPLIEELLEESPGEQPRKPRLLGHSLRYM      1 - 70
LELYRRSADSHGHPRENRTIGATMVRLVKPLTNVARPHRGTWHIQILGFPLRPNRGLYQLVRATVVYRHH     71 - 140
LQLTRFNLSCHVEPWVQKNPTNHFPSSEGDSSKPSLMSNAWKEMDITQLVQQRFWNNKGHRILRLRFMCQ    141 - 210
QQKDSGGLELWHGTSSLDIAFLLLYFNDTHKSIRKAKFLPRGMEEFMERESLLRRTRQADGISAEVTASS    211 - 280
SKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQ    281 - 350
SVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR                                351 - 392
//

Text Mined References (66)

PMID Year Title