Property Summary

NCBI Gene PubMed Count 33
PubMed Score 55.10
PubTator Score 49.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Cocaine Dependence 51
Disease Target Count P-value
osteosarcoma 7950 3.3e-05
tuberculosis 2010 6.8e-05
type I diabetes mellitus 22 1.0e-02
active Crohn's disease 922 3.1e-02
Disease Target Count Z-score Confidence
Human immunodeficiency virus infectious disease 138 3.307 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease -1.156 3.1e-02
osteosarcoma -2.287 3.3e-05
tuberculosis 2.000 6.8e-05
type I diabetes mellitus -1.486 1.0e-02

 CSPA Cell Line (2)

Gene RIF (27)

AA Sequence

MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSP      1 - 70
ETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTV     71 - 140
TGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL                                 141 - 181
//

Text Mined References (33)

PMID Year Title