Property Summary

NCBI Gene PubMed Count 33
Grant Count 132
R01 Count 97
Funding $11,245,192.11
PubMed Score 52.59
PubTator Score 49.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.287 0.000
tuberculosis 2.000 0.000
active Crohn's disease -1.156 0.031
type I diabetes mellitus -1.486 0.010

Synonym

Accession O95971
Symbols NK1
BY55
NK28

Gene

Gene RIF (27)

PMID Text
26269596 analysis of how NK1 receptor Gs versus Gq proteins and beta-arrestin signaling is determined by interactions in the water hydrogen bond network
26071079 elevated CD160 expression on natural killer (NK) cells plays an important role in NK cell loss in atherosclerosis.
25615279 CD160FCA offers a simple assay for minimal residual disease detection in CLL and gives prognostic information across different CLL risk groups.
25470765 CD160 and CD200 are expressed in B cells in chronic lymphocytic leukemia and are absent in other mature B-cell neoplasms.
25449536 identified 13 ADCC-activated genes. Six gene expression assays including 8 of the 13 genes (CCL3, CCL4/CCL4L1/CCL4L2, CD160, IFNG, NR4A3 and XCL1/XCL2) were analyzed in 127 kidney biopsies
25277889 report high frequencies of CD160 on CD8+ T cells, with significantly higher levels on HTLV-1 specific CD8+ T cells
25179432 Antibodies targeting CD160-GPI complement the blockade of PD-1 to enhance HIV-specific T-cell responses and warrant further investigation in the development of novel immunotherapeutic approaches.
25044837 A population of CD4+ CD160+ T lymphocytes was identified in circulating cutaneous T cells.
24882258 Data suggest that CD160 may become a useful marker in the clinical diagnosis and prognosis of chronic lymphocytic leukemia.
23761635 CD160-expressing human NK cells are costimulated by HVEM expressed in the environment to enhance cytolytic function and cytokine production.
More...

AA Sequence

MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSP      1 - 70
ETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTV     71 - 140
TGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL                                 141 - 181
//

Publication (33)

PMID Year Title
26269596 2015 Biased Gs versus Gq proteins and ?-arrestin signaling in the NK1 receptor determined by interactions in the water hydrogen bond network.
26071079 2015 Increased CD160 expression on circulating natural killer cells in atherogenesis.
25615279 2015 Minimal residual disease detection with tumor-specific CD160 correlates with event-free survival in chronic lymphocytic leukemia.
25470765 2015 Combination of CD160 and CD200 as a useful tool for differential diagnosis between chronic lymphocytic leukemia and other mature B-cell neoplasms.
25449536 2015 Genes associated with antibody-dependent cell activation are overexpressed in renal biopsies from patients with antibody-mediated rejection.
25416956 2014 A proteome-scale map of the human interactome network.
25277889 2014 CD160 expression defines a uniquely exhausted subset of T lymphocytes in HTLV-1 infection.
25179432 2014 CD160 isoforms and regulation of CD4 and CD8 T-cell responses.
25044837 2014 Membrane expression of NK receptors CD160 and CD158k contributes to delineate a unique CD4+ T-lymphocyte subset in normal and mycosis fungoides skin.
24882258 2015 High levels of CD160 expression up-regulated counts of chronic lymphocytic leukemia cells and were associated with other clinical parameters in Chinese patients with chronic lymphocytic leukemia.
More...