Property Summary

NCBI Gene PubMed Count 63
PubMed Score 342.70
PubTator Score 235.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -3.500 9.6e-07
astrocytic glioma -2.600 8.9e-03
Astrocytoma, Pilocytic -4.200 4.3e-08
atypical teratoid / rhabdoid tumor -3.700 7.1e-05
colon cancer -1.500 1.3e-04
glioblastoma -3.400 3.4e-06
group 3 medulloblastoma -1.700 1.6e-03
interstitial cystitis -1.200 3.7e-03
medulloblastoma, large-cell -5.500 2.2e-08
oligodendroglioma -2.200 1.3e-11
primitive neuroectodermal tumor -3.500 2.1e-03
psoriasis -1.400 1.8e-26

Gene RIF (54)

AA Sequence

MESERSKRMGNACIPLKRIAYFLCLLSALLLTEGKKPAKPKCPAVCTCTKDNALCENARSIPRTVPPDVI      1 - 70
SLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKS     71 - 140
LIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRK    141 - 210
INSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITG    211 - 280
TSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVAD    281 - 350
SSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLF    351 - 420
TNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYA    421 - 490
ILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA       491 - 557
//

Text Mined References (65)

PMID Year Title