Property Summary

NCBI Gene PubMed Count 14
PubMed Score 56.85
PubTator Score 19.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer -3.500 2.5e-04
adult high grade glioma 1.300 1.8e-03
breast carcinoma -1.300 1.3e-03
cutaneous lupus erythematosus -3.200 5.6e-03
ependymoma 1.200 8.5e-04
intraductal papillary-mucinous adenoma (... -1.200 2.0e-03
intraductal papillary-mucinous carcinoma... -1.300 1.5e-03
intraductal papillary-mucinous neoplasm ... -1.100 2.5e-02
ovarian cancer 2.300 6.9e-04
psoriasis -2.700 3.4e-06

Gene RIF (6)

AA Sequence

MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKLGVKRCTDQMS      1 - 70
LQKRSLIAEVLVKILKKCSV                                                       71 - 90
//

Text Mined References (14)

PMID Year Title