Property Summary

NCBI Gene PubMed Count 14
Grant Count 10
R01 Count 10
Funding $770,765.4
PubMed Score 56.16
PubTator Score 19.39

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
24603286 The data indicate that MGB1, MGB2 and LIPB mRNAs are expressed at low levels in human tissues but basal expression is upregulated in ovarian cancer.
23819652 lipophilin B gene overexpression correlates with a less aggressive tumor phenotype and represents a novel ovarian carcinoma prognostic factor
18630503 Ectopic overexpression of mammaglobin and lipophilin B did not affect the cell proliferation rate of Hs578T breast carcinoma cells in vitro.
17163411 We conclude that expression of LPB is preferentially but not exclusively restricted to breast tissue.
15668787 The present report demonstrates, for the first time, lipophilin B expression in the pituitary and its apparent down-regulation in pituitary adenomas.
12576445 Serum antibodies to this protein are detected in late stage breast cancer patients.

AA Sequence

MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKLGVKRCTDQMS      1 - 70
LQKRSLIAEVLVKILKKCSV                                                       71 - 90
//

Text Mined References (14)

PMID Year Title
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24603286 2014 Differential expression of secretoglobins in normal ovary and in ovarian carcinoma--overexpression of mammaglobin-1 is linked to tumor progression.
23819652 2013 Secretoglobin expression in ovarian carcinoma: lipophilin B gene upregulation as an independent marker of better prognosis.
22155607 2011 Update of the human secretoglobin (SCGB) gene superfamily and an example of 'evolutionary bloom' of androgen-binding protein genes within the mouse Scgb gene superfamily.
18630503 Mammaglobin and lipophilin B expression in breast tumors and their lack of effect on breast cancer cell proliferation.
17163411 2007 Lipophilin B: A gene preferentially expressed in breast tissue and upregulated in breast cancer.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15668787 2005 Secretoglobins in the human pituitary: high expression of lipophilin B and its down-regulation in pituitary adenomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12576445 2003 Serum antibodies to lipophilin B detected in late stage breast cancer patients.
More...