Property Summary

NCBI Gene PubMed Count 8
Grant Count 26
R01 Count 14
Funding $3,022,262.6
PubMed Score 140.30
PubTator Score 19.50

Knowledge Summary

Patent

No data available

AA Sequence

MRLSVCLLLLTLALCCYRANAVVCQALGSEITGFLLAGKPVFKFQLAKFKAPLEAVAAKMEVKKCVDTMA      1 - 70
YEKRVLITKTLGKIAEKCDR                                                       71 - 90
//

Publication (9)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22155607 2011 Update of the human secretoglobin (SCGB) gene superfamily and an example of 'evolutionary bloom' of androgen-binding protein genes within the mouse Scgb gene superfamily.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10066439 1999 Lipophilins: human peptides homologous to rat prostatein.
9720917 1998 Lipophilin, a novel heterodimeric protein of human tears.