Property Summary

NCBI Gene PubMed Count 8
PubMed Score 142.30
PubTator Score 19.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 2.3e-13
Breast cancer 3578 1.5e-08
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

AA Sequence

MRLSVCLLLLTLALCCYRANAVVCQALGSEITGFLLAGKPVFKFQLAKFKAPLEAVAAKMEVKKCVDTMA      1 - 70
YEKRVLITKTLGKIAEKCDR                                                       71 - 90
//

Text Mined References (9)

PMID Year Title