Property Summary

NCBI Gene PubMed Count 42
Grant Count 32
R01 Count 26
Funding $2,600,539.91
PubMed Score 46.20
PubTator Score 38.21

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
25885889 Data indicates that Fibulin-4 is a novel gene that is found overexpressed in ovarian cancer and associated with poor prognostic clinicopathologic features.
25255451 pulmonary emphysema in aneurysmal Fibulin-4 deficient (Fibulin-4(R)) mice
24838734 Homozygous mutations in exon 7 of the FBLN4 gene can produce lethal vasculopathy.
24737201 This study demonstrated that fibulin-4 may serve as a new prognostic factor and as a potential therapeutic target for patients with cervical carcinoma.
23782690 Solid phase binding assays detected strong calcium-dependent binding of the short fibulins to immobilized heparin, suggesting that these fibulins may bind cell surface-located heparan sulfate
23518852 Studied Fibulin-4 expression in aortic wall to find out its role in aortic dissection development. Used samples of aortic wall from 10 patients operated for acute ascending aortic dissection and five patients for chronic ascending aortic dissection.
23313295 Low EFEMP2 expression is associated with malignant pleural mesothelioma.
22943132 A lethal, genetic disorder characterized by severe deformation of elastic arteries, was linked to novel mutations in the FBLN4 gene.
22919265 EFEMP2 is a novel PITX2-interacting protein that may bear importance for the development of anterior segment dysgenesis (ASD) and glaucoma.
22829427 Data indicate mutations of FBLN4, FBLN5, and LTBP4 in 12 probands presenting with type 1 recessive cutis laxa.
More...

AA Sequence

MLPCASCLPGSLLLWALLLLLLGSASPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLTIPEACKGEMK      1 - 70
CINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCVDVDECAQALHDCRPSQDC     71 - 140
HNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMG    141 - 210
APCEQRCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYRCINEPGRFSCHCPQGYQLLATRL    211 - 280
CQDIDECESGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYIQVSENRCLCPASNPLCREQPSSIVHRYMTI    281 - 350
TSERSVPADVFQIQATSVYPGAYNAFQIRAGNSQGDFYIRQINNVSAMLVLARPVTGPREYVLDLEMVTM    351 - 420
NSLMSYRASSVLRLTVFVGAYTF                                                   421 - 443
//

Publication (44)

PMID Year Title
25885889 2015 Fibulin-4 is associated with tumor progression and a poor prognosis in ovarian carcinomas.
25416956 2014 A proteome-scale map of the human interactome network.
25255451 2014 Extracellular matrix defects in aneurysmal Fibulin-4 mice predispose to lung emphysema.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24838734 2014 Imaging findings in a distinct lethal inherited arteriopathy syndrome associated with a novel mutation in the FBLN4 gene.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24737201 2014 Overexpression of fibulin-4 is associated with tumor progression and poor prognosis in patients with cervical carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23782690 2013 Fibulin-3, -4, and -5 are highly susceptible to proteolysis, interact with cells and heparin, and form multimers.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...