Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.05
PubTator Score 6.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
Breast cancer 3099 7.57916066870992E-17
posterior fossa group A ependymoma 1511 1.47524036724121E-8
Atopic dermatitis 944 1.32272032353651E-5
non-small cell lung cancer 2798 3.56414630358032E-5
invasive ductal carcinoma 2950 8.74913913367827E-5
pituitary cancer 1972 1.27363013840846E-4
primary pancreatic ductal adenocarcinoma 1271 1.46799378420212E-4
malignant mesothelioma 3163 0.00213912065606174
head and neck cancer 270 0.00247840601266442
osteosarcoma 7933 0.00338838092597846
pancreatic cancer 2300 0.00425140879204729
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00528681774838796
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00774564455516897
psoriasis 6685 0.00852069291544813
lung adenocarcinoma 2714 0.00946908026172232
adult high grade glioma 2148 0.00991579047421094
cystic fibrosis 1670 0.0130614022453106
interstitial cystitis 2299 0.0195485752657429
sonic hedgehog group medulloblastoma 1482 0.0228332114361861
lung cancer 4473 0.0266417952615941
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0267741570680038
ovarian cancer 8492 0.0281263431964444
gastric carcinoma 832 0.0445816175493081
glioblastoma 5572 0.0494603223191333
cutaneous lupus erythematosus 1056 0.0497803904618076

Expression

Synonym

Accession O95965 A8K5M5 B3KTP1 B4DQ02 Q8N172 Q9NPR0
Symbols OSCP
TIED

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

 GO Component (1)

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (4)

PMID Text
26060017 Data indicate the transforming growth factor beta (TGFbeta) signaling pathway as a downstream effector of integrin beta-like 1 (ITGBL1) and the transcription factor Runx2 as an upstream activator of ITGBL1 expression.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCD      1 - 70
CGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSN     71 - 140
QMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAG    141 - 210
WHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVY    211 - 280
DRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYP    281 - 350
PGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADG    351 - 420
ILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLG    421 - 490
SEYP                                                                      491 - 494
//

Text Mined References (18)

PMID Year Title
26060017 2015 ITGBL1 Is a Runx2 Transcriptional Target and Promotes Breast Cancer Bone Metastasis by Activating the TGF? Signaling Pathway.
24132900 2013 Genome-wide association study of atypical psychosis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
23145134 2012 Mid-gestational gene expression profile in placenta and link to pregnancy complications.
21284329 2010 Identification of two novel chromosome regions associated with isolated growth hormone deficiency.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...