Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.42
PubTator Score 6.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma 1.100 9.9e-03
Atopic dermatitis -1.900 1.3e-05
Breast cancer -2.800 7.6e-17
cutaneous lupus erythematosus -1.100 5.0e-02
cystic fibrosis -1.320 3.1e-05
ependymoma 1.500 2.5e-03
gastric carcinoma 2.400 4.5e-02
glioblastoma 1.400 4.9e-02
head and neck cancer -1.800 2.1e-02
interstitial cystitis -1.100 2.0e-02
intraductal papillary-mucinous adenoma (... -2.900 7.7e-03
intraductal papillary-mucinous carcinoma... -3.400 5.3e-03
intraductal papillary-mucinous neoplasm ... -3.300 2.7e-02
invasive ductal carcinoma 2.885 8.7e-05
lung adenocarcinoma 1.311 9.5e-03
lung cancer -1.400 2.7e-02
malignant mesothelioma -1.200 2.1e-03
medulloblastoma 1.500 2.9e-02
non-small cell lung cancer -1.163 3.6e-05
osteosarcoma -2.425 3.7e-02
ovarian cancer 2.300 2.8e-02
pancreatic cancer 1.400 2.5e-02
pituitary cancer -2.200 3.1e-06
primary pancreatic ductal adenocarcinoma 1.810 2.2e-02
psoriasis -1.100 8.6e-03

Gene RIF (6)

AA Sequence

MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCD      1 - 70
CGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSN     71 - 140
QMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAG    141 - 210
WHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVY    211 - 280
DRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYP    281 - 350
PGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADG    351 - 420
ILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLG    421 - 490
SEYP                                                                      491 - 494
//

Text Mined References (20)

PMID Year Title