Property Summary

NCBI Gene PubMed Count 10
Grant Count 16
R01 Count 12
Funding $942,154.74
PubMed Score 157.65
PubTator Score 63.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (5)

PMID Text
26547929 Data show that ONECUT2, IGF2BP1, and ANXA2 proteins were confirmed to be microRNA-9 (miR-9) targets and aberrantly upregulated in hepatocellular carcinoma (HCC).
24402783 our data showed that transcript factor Onecut2 is involved in the EMT, migration and invasion of CRC cells; miR-429 inhibits the initiation of EMT and regulated expression of EMT-related markers
23472758 Mutations at the -5/-6 site of the F9 promotor account for the majority of hemophilia B Leyden cases and disrupt the binding of ONECUT1 and ONECUT2.
18418398 OC2 transcription factor is a direct target of T-bet in type-1 T-helper cells.
18288132 A CpG island proximal to ONECUT2 is frequently methylated in diffuse large B-cell lymphoma (DLBCL).

AA Sequence

MKAAYTAYRCLTKDLEGCAMNPELTMESLGTLHGPAGGGSGGGGGGGGGGGGGGPGHEQELLASPSPHHA      1 - 70
GRGAAGSLRGPPPPPTAHQELGTAAAAAAAASRSAMVTSMASILDGGDYRPELSIPLHHAMSMSCDSSPP     71 - 140
GMGMSNTYTTLTPLQPLPPISTVSDKFHHPHPHHHPHHHHHHHHQRLSGNVSGSFTLMRDERGLPAMNNL    141 - 210
YSPYKEMPGMSQSLSPLAATPLGNGLGGLHNAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRG    211 - 280
LGTPPAAMMSHLNGLHHPGHTQSHGPVLAPSRERPPSSSSGSQVATSGQLEEINTKEVAQRITAELKRYS    281 - 350
IPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALRLAACKRKEQEPNK    351 - 420
DRNNSQKKSRLVFTDLQRRTLFAIFKENKRPSKEMQITISQQLGLELTTVSNFFMNARRRSLEKWQDDLS    421 - 490
TGGSSSTSSTCTKA                                                            491 - 504
//

Publication (11)

PMID Year Title
26547929 2015 Comprehensive profiling of novel microRNA-9 targets and a tumor suppressor role of microRNA-9 via targeting IGF2BP1 in hepatocellular carcinoma.
24402783 2014 MiR-429 inhibits cells growth and invasion and regulates EMT-related marker genes by targeting Onecut2 in colorectal carcinoma.
23472758 2013 A CpG mutational hotspot in a ONECUT binding site accounts for the prevalent variant of hemophilia B Leyden.
18418398 2008 Onecut transcription factor OC2 is a direct target of T-bet in type-1 T-helper cells.
18288132 2008 DNA methylation profiles in diffuse large B-cell lymphoma and their relationship to gene expression status.
16912168 2006 MIRA-assisted microarray analysis, a new technology for the determination of DNA methylation patterns, identifies frequent methylation of homeodomain-containing genes in lung cancer cells.
16177791 2005 DNA sequence and analysis of human chromosome 18.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11478782 2001 The transcription factor onecut-2 controls the microphthalmia-associated transcription factor gene.
More...