Property Summary

NCBI Gene PubMed Count 11
PubMed Score 169.48
PubTator Score 63.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 4.6e-06
gastric carcinoma 3.200 1.9e-02
group 3 medulloblastoma 1.500 6.3e-04
invasive ductal carcinoma 2.400 3.0e-02
medulloblastoma, large-cell 2.300 2.0e-03
osteosarcoma 1.100 5.0e-03
ovarian cancer 1.400 2.2e-09
pancreatic cancer 1.100 1.2e-02
posterior fossa group A ependymoma -1.100 7.0e-12
primary pancreatic ductal adenocarcinoma 1.313 1.5e-02

Gene RIF (6)

AA Sequence

MKAAYTAYRCLTKDLEGCAMNPELTMESLGTLHGPAGGGSGGGGGGGGGGGGGGPGHEQELLASPSPHHA      1 - 70
GRGAAGSLRGPPPPPTAHQELGTAAAAAAAASRSAMVTSMASILDGGDYRPELSIPLHHAMSMSCDSSPP     71 - 140
GMGMSNTYTTLTPLQPLPPISTVSDKFHHPHPHHHPHHHHHHHHQRLSGNVSGSFTLMRDERGLPAMNNL    141 - 210
YSPYKEMPGMSQSLSPLAATPLGNGLGGLHNAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRG    211 - 280
LGTPPAAMMSHLNGLHHPGHTQSHGPVLAPSRERPPSSSSGSQVATSGQLEEINTKEVAQRITAELKRYS    281 - 350
IPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALRLAACKRKEQEPNK    351 - 420
DRNNSQKKSRLVFTDLQRRTLFAIFKENKRPSKEMQITISQQLGLELTTVSNFFMNARRRSLEKWQDDLS    421 - 490
TGGSSSTSSTCTKA                                                            491 - 504
//

Text Mined References (12)

PMID Year Title