Property Summary

NCBI Gene PubMed Count 39
PubMed Score 100.66
PubTator Score 19.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.4
Disease Target Count Z-score Confidence
Cancer 2499 3.588 1.8

Gene RIF (33)

AA Sequence

MAWRALHPLLLLLLLFPGSQAQSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSS      1 - 70
KPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSW     71 - 140
TPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAPIALVPVFCGLLVAKSLVLSA    141 - 210
LLVWWGDIWWKTMMELRSLDTQKATCHLQQVTDLPWTSVSSPVEREILYHTVARTKISDDDDEHTL        211 - 276
//

Text Mined References (39)

PMID Year Title