Property Summary

NCBI Gene PubMed Count 39
Grant Count 12
R01 Count 1
Funding $816,159.58
PubMed Score 92.17
PubTator Score 19.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cancer 2,346 3.5 1.8
Alzheimer's disease 644 1.0

Gene RIF (33)

PMID Text
24824867 On CD56(+) CD3(-) cells, NKp44 and NKp46 expressions were high in the acute hepatitis E patients, whereas NKp30, NKp44, NKp46 and NKG2D were high in the recovered individuals.
24673109 Balance between activating NKG2D, DNAM-1, NKp44 and NKp46 and inhibitory CD94/NKG2A receptors determine natural killer degranulation towards rheumatoid arthritis synovial fibroblasts.
24658504 NCR(+) ILC3 from skin and blood of psoriasis patients produced IL-22, which is regarded as a key driver of epidermal thickening, suggesting that NCR(+) ILC3 may participate in psoriasis pathology.
24352038 NKp44+ ILC3 are expressed in human skin and blood and may have a role in psoriasis pathogenesis
24154937 demonstrated that the mitogen and iK562 exposure to peripheral blood mononuclear cells can significantly improve NK activity which is co-related to the higher expression of NKp44 and NKG2D
24044960 Expression of NKp44 ligand by normal articular chondrocytes is not involved in their killing by unstimulated NK cells; however, it is responsible for anti-chondrocyte cytotoxicity mediated by long-term activated NK cells.
23958951 MLL5 is a cellular ligand for the natural cytotoxicity receptor NKp44.
23818644 Natural killer cells in HIV controller patients express an activated effector phenotype and do not up-regulate NKp44 on IL-2 stimulation.
23791642 triggering in RORgammat-positive innate lymphoid cells selectively activates a proinflammatory program
23578092 While interaction of TLR2 with mycobacterial cell wall promotes activation of resting NK cells and IFN-gamma production, NKp44 interaction with its putative ligands could play a secondary role in maintaining cell activation
More...

AA Sequence

MAWRALHPLLLLLLLFPGSQAQSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSS      1 - 70
KPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSW     71 - 140
TPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAPIALVPVFCGLLVAKSLVLSA    141 - 210
LLVWWGDIWWKTMMELRSLDTQKATCHLQQVTDLPWTSVSSPVEREILYHTVARTKISDDDDEHTL        211 - 276
//

Publication (39)

PMID Year Title
24824867 2014 Increased expressions of NKp44, NKp46 on NK/NKT-like cells are associated with impaired cytolytic function in self-limiting hepatitis E infection.
24673109 2014 Balance between activating NKG2D, DNAM-1, NKp44 and NKp46 and inhibitory CD94/NKG2A receptors determine natural killer degranulation towards rheumatoid arthritis synovial fibroblasts.
24658504 2014 Composition of innate lymphoid cell subsets in the human skin: enrichment of NCR(+) ILC3 in lesional skin and blood of psoriasis patients.
24352038 2014 Characterization of innate lymphoid cells in human skin and blood demonstrates increase of NKp44+ ILC3 in psoriasis.
24154937 2014 Augmenting the expression of NKp44 molecule and the natural killer activity in peripheral blood mononuclear cells from patients with malignant colorectal carcinoma.
24044960 Constitutive expression of ligand for natural killer cell NKp44 receptor (NKp44L) by normal human articular chondrocytes.
23958951 2013 Identification of a cellular ligand for the natural cytotoxicity receptor NKp44.
23818644 2013 Natural killer cells in HIV controller patients express an activated effector phenotype and do not up-regulate NKp44 on IL-2 stimulation.
23791642 2013 ROR?t? innate lymphoid cells acquire a proinflammatory program upon engagement of the activating receptor NKp44.
23578092 2013 Interaction of Mycobacterium tuberculosis cell wall components with the human natural killer cell receptors NKp44 and Toll-like receptor 2.
More...