Property Summary

NCBI Gene PubMed Count 38
Grant Count 146
R01 Count 100
Funding $15,487,118.07
PubMed Score 201.93
PubTator Score 57.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession O95936 B7Z4I2 B7ZA51 G3XAI5 Q8TAZ2 Q9UPM7
Symbols TBR2

Gene

PANTHER Protein Class (1)

 GO Component (1)

Gene RIF (26)

PMID Text
26762769 EOMES expression was low in multiple sclerosis (MS), and stable over time. The low EOMES/TBX21 phenotype in MS reflects cd56+ cell dysregulation.
26753694 we identified a higher Eomes mRNA expression as an independent good prognostic factor for OS and PFS in mRCC patients treated with sorafenib.
26438526 the level of T-bet and Eomesodermin, two T-box transcription factors regulating lymphocyte effector functions, is strongly reduced in NK cells from allogeneic hematopoietic stem cell transplantation recipients compared with healthy control subjects.
26436530 Eomes(+) CD4(+) T cells are increased in the peripheral blood and cerebrospinal fluid from patients in a progressive state of multiple sclerosis.
25649652 This study showed that EOMES (rs2724509; flanking) associated with Alzheimer disease.
25517360 Report a global loss of 5hmC identified three new genes (ECM1, ATF5, and EOMES) with potential anti-cancer functions that may promote the understanding of the molecular mechanisms of hepatocellular carcinoma development and progression.
25032686 This study supports the concept that poor human viral-specific CD8(+) T cell functionality is due to an inverse expression balance between T-bet and Eomes
24841128 HIV-1 Tat upregulates the expression of T-bet, Eomesdermin, Blimp-1, Bcl-6, and Bcl-2 in stimulated but not in unstimulated CD8+ T lymphocytes
24651531 HHEX promotes hepatic specification by repressing EOMES expression.
24495857 The autoimmune disease-associated transcription factors EOMES and TBX21 are dysregulated in multiple sclerosis and define a molecular subtype of disease.
More...

AA Sequence

MQLGEQLLVSSVNLPGAHFYPLESARGGSGGSAGHLPSAAPSPQKLDLDKASKKFSGSLSCEAVSGEPAA      1 - 70
ASAGAPAAMLSDTDAGDAFASAAAVAKPGPPDGRKGSPCGEEELPSAAAAAAAAAAAAAATARYSMDSLS     71 - 140
SERYYLQSPGPQGSELAAPCSLFPYQAAAGAPHGPVYPAPNGARYPYGSMLPPGGFPAAVCPPGRAQFGP    141 - 210
GAGAGSGAGGSSGGGGGPGTYQYSQGAPLYGPYPGAAAAGSCGGLGGLGVPGSGFRAHVYLCNRPLWLKF    211 - 280
HRHQTEMIITKQGRRMFPFLSFNINGLNPTAHYNVFVEVVLADPNHWRFQGGKWVTCGKADNNMQGNKMY    281 - 350
VHPESPNTGSHWMRQEISFGKLKLTNNKGANNNNTQMIVLQSLHKYQPRLHIVEVTEDGVEDLNEPSKTQ    351 - 420
TFTFSETQFIAVTAYQNTDITQLKIDHNPFAKGFRDNYDSSHQIVPGGRYGVQSFFPEPFVNTLPQARYY    421 - 490
NGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHA    491 - 560
LGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDS    561 - 630
NDSGVYTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGMGGYYAFYTTP                  631 - 686
//

Text Mined References (43)

PMID Year Title
26762769 2016 The low EOMES/TBX21 molecular phenotype in multiple sclerosis reflects CD56+ cell dysregulation and is affected by immunomodulatory therapies.
26753694 2016 Favorable prognostic influence of T-box transcription factor Eomesodermin in metastatic renal cell cancer patients.
26438526 2015 NK Cell Functional Impairment after Allogeneic Hematopoietic Stem Cell Transplantation Is Associated with Reduced Levels of T-bet and Eomesodermin.
26436530 2015 Eomesodermin-expressing T-helper cells are essential for chronic neuroinflammation.
25649652 2015 Linking Genetics of Brain Changes to Alzheimer's Disease: Sparse Whole Genome Association Scan of Regional MRI Volumes in the ADNI and AddNeuroMed Cohorts.
25517360 2014 Integrated analyses of DNA methylation and hydroxymethylation reveal tumor suppressive roles of ECM1, ATF5, and EOMES in human hepatocellular carcinoma.
25032686 2014 T-bet and Eomes are differentially linked to the exhausted phenotype of CD8+ T cells in HIV infection.
24651531 2014 HHEX promotes hepatic-lineage specification through the negative regulation of eomesodermin.
24495857 2014 The autoimmune disease-associated transcription factors EOMES and TBX21 are dysregulated in multiple sclerosis and define a molecular subtype of disease.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
More...