Property Summary

NCBI Gene PubMed Count 41
PubMed Score 230.41
PubTator Score 57.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
group 3 medulloblastoma 5.300 1.1e-03
head and neck cancer and chronic obstruc... 1.300 6.5e-03
interstitial cystitis 2.200 4.1e-03
osteosarcoma -3.457 2.5e-05
primary Sjogren syndrome 1.400 8.0e-05
subependymal giant cell astrocytoma -2.133 3.0e-02
ulcerative colitis 1.100 3.2e-03

 GO Component (1)

Gene RIF (29)

AA Sequence

MQLGEQLLVSSVNLPGAHFYPLESARGGSGGSAGHLPSAAPSPQKLDLDKASKKFSGSLSCEAVSGEPAA      1 - 70
ASAGAPAAMLSDTDAGDAFASAAAVAKPGPPDGRKGSPCGEEELPSAAAAAAAAAAAAAATARYSMDSLS     71 - 140
SERYYLQSPGPQGSELAAPCSLFPYQAAAGAPHGPVYPAPNGARYPYGSMLPPGGFPAAVCPPGRAQFGP    141 - 210
GAGAGSGAGGSSGGGGGPGTYQYSQGAPLYGPYPGAAAAGSCGGLGGLGVPGSGFRAHVYLCNRPLWLKF    211 - 280
HRHQTEMIITKQGRRMFPFLSFNINGLNPTAHYNVFVEVVLADPNHWRFQGGKWVTCGKADNNMQGNKMY    281 - 350
VHPESPNTGSHWMRQEISFGKLKLTNNKGANNNNTQMIVLQSLHKYQPRLHIVEVTEDGVEDLNEPSKTQ    351 - 420
TFTFSETQFIAVTAYQNTDITQLKIDHNPFAKGFRDNYDSSHQIVPGGRYGVQSFFPEPFVNTLPQARYY    421 - 490
NGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHA    491 - 560
LGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDS    561 - 630
NDSGVYTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGMGGYYAFYTTP                  631 - 686
//

Text Mined References (46)

PMID Year Title