Property Summary

NCBI Gene PubMed Count 11
Grant Count 18
R01 Count 16
Funding $3,834,552.5
PubMed Score 50.82
PubTator Score 19.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.525 0.000
non primary Sjogren syndrome sicca -1.200 0.027
ovarian cancer 1.100 0.000

Gene RIF (4)

PMID Text
26235987 Mutations in TBX18 cause dominant urinary tract malformations via transcriptional dysregulation of ureter development.
23749171 The DNA sequence variants within the TBX18 gene promoter identified in ventricular septal defects (VSD) patients may be involved in the VSD etiology.
21205823 connexin43 transcriptional suppression by TBX18 undermines cardiomyocyte cell-cell electrical coupling
17584735 Tbx18 interacts with Gata4 and Nkx2-5 and competes Tbx5-mediated activation of the cardiac Natriuretic peptide precursor type a-promoter. Tbx18 down-regulates Tbx6-activated Delta-like 1 expression in the somitic mesoderm in vivo

AA Sequence

MAEKRRGSPCSMLSLKAHAFSVEALIGAEKQQQLQKKRRKLGAEEAAGAVDDGGCSRGGGAGEKGSSEGD      1 - 70
EGAALPPPAGATSGPARSGADLERGAAGGCEDGFQQGASPLASPGGSPKGSPARSLARPGTPLPSPQAPR     71 - 140
VDLQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMV    141 - 210
AGNADSPVPPRVYIHPDSPASGETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDD    211 - 280
LSPIKPVPSGEGVKAFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRMGLEALVESYAFWRP    281 - 350
SLRTLTFEDIPGIPKQGNASSSTLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSAC    351 - 420
ARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTFSCPQTSLSMQIS    421 - 490
GMSPQLQYIMPSPSSNAFATNQTHQGSYNTFRLHSPCALYGYNFSTSPKLAASPEKIVSSQGSFLGSSPS    491 - 560
GTMTDRQMLPPVEGVHLLSSGGQQSFFDSRTLGSLTLSSSQVSAHMV                           561 - 607
//

Text Mined References (12)

PMID Year Title
26235987 2015 Mutations in TBX18 Cause Dominant Urinary Tract Malformations via Transcriptional Dysregulation of Ureter Development.
25364816 2014 A genome-wide association study for diabetic retinopathy in a Japanese population: potential association with a long intergenic non-coding RNA.
23749171 2013 Novel and functional variants within the TBX18 gene promoter in ventricular septal defects.
23242162 2013 Direct conversion of quiescent cardiomyocytes to pacemaker cells by expression of Tbx18.
21205823 2011 Transcriptional suppression of connexin43 by TBX18 undermines cell-cell electrical coupling in postnatal cardiomyocytes.
19213963 2009 Setting the pace: Tbx3 and Tbx18 in cardiac conduction system development.
17584735 2007 Transcriptional repression by the T-box proteins Tbx18 and Tbx15 depends on Groucho corepressors.
16688725 2006 T-genes and limb bud development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...