Property Summary

NCBI Gene PubMed Count 13
PubMed Score 54.56
PubTator Score 19.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.200 2.7e-02
osteosarcoma 1.525 3.3e-06
ovarian cancer 1.100 8.5e-08

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MAEKRRGSPCSMLSLKAHAFSVEALIGAEKQQQLQKKRRKLGAEEAAGAVDDGGCSRGGGAGEKGSSEGD      1 - 70
EGAALPPPAGATSGPARSGADLERGAAGGCEDGFQQGASPLASPGGSPKGSPARSLARPGTPLPSPQAPR     71 - 140
VDLQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMV    141 - 210
AGNADSPVPPRVYIHPDSPASGETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDD    211 - 280
LSPIKPVPSGEGVKAFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRMGLEALVESYAFWRP    281 - 350
SLRTLTFEDIPGIPKQGNASSSTLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSAC    351 - 420
ARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTFSCPQTSLSMQIS    421 - 490
GMSPQLQYIMPSPSSNAFATNQTHQGSYNTFRLHSPCALYGYNFSTSPKLAASPEKIVSSQGSFLGSSPS    491 - 560
GTMTDRQMLPPVEGVHLLSSGGQQSFFDSRTLGSLTLSSSQVSAHMV                           561 - 607
//

Text Mined References (14)

PMID Year Title