Property Summary

Ligand Count 7
NCBI Gene PubMed Count 39
PubMed Score 29.78
PubTator Score 28.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -2.200 1.4e-05
Astrocytoma, Pilocytic -1.300 9.3e-06
atypical teratoid / rhabdoid tumor -3.400 3.6e-11
Breast cancer -1.900 2.0e-18
breast carcinoma -1.300 7.1e-06
dermatomyositis 1.100 8.9e-04
ductal carcinoma in situ -1.200 9.2e-05
ependymoma -1.200 5.0e-02
glioblastoma -2.200 2.9e-09
group 3 medulloblastoma -1.800 2.7e-04
invasive ductal carcinoma -2.100 7.0e-04
lung adenocarcinoma -1.300 1.1e-21
lung cancer -2.600 3.3e-06
medulloblastoma, large-cell -4.200 1.5e-07
non-small cell lung cancer -1.665 2.6e-23
osteosarcoma -2.157 4.2e-03
ovarian cancer -2.100 1.5e-10
primitive neuroectodermal tumor -2.600 2.3e-05
psoriasis -1.300 4.5e-08
subependymal giant cell astrocytoma -1.762 1.2e-03

Protein-protein Interaction (9)

Gene RIF (23)

AA Sequence

MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYR      1 - 70
KRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLR     71 - 140
KPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPP    141 - 210
WTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF                                 211 - 251
//

Text Mined References (41)

PMID Year Title