Property Summary

NCBI Gene PubMed Count 34
Grant Count 14
R01 Count 8
Funding $758,213.7
PubMed Score 24.55
PubTator Score 28.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
posterior fossa group A ependymoma -2.100 0.000
psoriasis -1.300 0.000
glioblastoma -2.800 0.000
osteosarcoma -2.157 0.004
sonic hedgehog group medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -4.200 0.000
primitive neuroectodermal tumor -2.600 0.000
non-small cell lung cancer -1.665 0.000
lung cancer -2.600 0.000
breast carcinoma -1.400 0.000
lung adenocarcinoma -1.900 0.000
pediatric high grade glioma -2.500 0.000
pilocytic astrocytoma -1.300 0.000
subependymal giant cell astrocytoma -1.762 0.001
Breast cancer -1.900 0.000
ductal carcinoma in situ -1.200 0.000
invasive ductal carcinoma -2.100 0.001
ovarian cancer -2.100 0.000
dermatomyositis 1.100 0.001

Gene RIF (23)

PMID Text
26416703 the miR-9 family of microRNAs (miRNAS) downregulates the expression of CBX7. In turn, CBX7 represses miR-9-1 and miR-9-2 as part of a regulatory negative feedback loop.
26343356 Data show that polycomb-group proteins BMI1, PHC3, CBX6 and CBX7 expression was significantly increased during imatinib treatment.
26216446 these results suggest that the retention of CBX7 expression may play a role in the modulation of chemosensitivity of lung cancer patients to the treatment with irinotecan and etoposide
25881303 Cbx7 is downregulated in CCs, and Cbx7 expression-low tumors correlated with lymph metastasis and poor overall survival of CC patients.
25596753 Aberrantly expressed miR-9 contributes to T24 cells invasion, partly through directly down-regulating CBX7 protein expression in bladder transitional cell carcinoma
25595895 CBX7/HMGA1b/NF-kappaB could take part in the same transcriptional mechanism that finally leads to the regulation of SPP1 gene expression in papillary thyroid carcinoma.
25351982 CBX7-mediated epigenetic induction of DKK-1 is crucial for the inhibition of breast tumorigenicity, suggesting that CBX7 could be a potential tumor suppressor in breast cancer.
24865347 Results suggest that the loss of CBX7 expression might play a critical role in advanced stages of carcinogenesis by deregulating the expression of specific effector genes.
24375438 we showed for the first time that CBX7 was associated with a decreased prognosis for clear cell adenocarcinoma of the ovary
22226354 MicroRNA regulation of Cbx7 mediates a switch of Polycomb orthologs during ESC differentiation.
More...

AA Sequence

MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYR      1 - 70
KRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLR     71 - 140
KPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPP    141 - 210
WTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF                                 211 - 251
//

Text Mined References (37)

PMID Year Title
26416703 2015 CBX7 and miR-9 are part of an autoregulatory loop controlling p16(INK) (4a).
26343356 2015 Polycomb genes are associated with response to imatinib in chronic myeloid leukemia.
26216446 2015 Restoration of CBX7 expression increases the susceptibility of human lung carcinoma cells to irinotecan treatment.
25881303 2015 Critical evaluation of Cbx7 downregulation in primary colon carcinomas and its clinical significance in Chinese patients.
25596753 2015 Up-regulation of miR-9 target CBX7 to regulate invasion ability of bladder transitional cell carcinoma.
25595895 2015 CBX7 and HMGA1b proteins act in opposite way on the regulation of the SPP1 gene expression.
25351982 2015 CBX7 inhibits breast tumorigenicity through DKK-1-mediated suppression of the Wnt/?-catenin pathway.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24865347 2014 CBX7 modulates the expression of genes critical for cancer progression.
24375438 2014 Expression of chromobox homolog 7 (CBX7) is associated with poor prognosis in ovarian clear cell adenocarcinoma via TRAIL-induced apoptotic pathway regulation.
More...