Property Summary

NCBI Gene PubMed Count 16
PubMed Score 12.32
PubTator Score 91.60

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 6.69805673730233E-13
ovarian cancer 8492 2.10681268486997E-6
Multiple myeloma 1328 0.00157034742855064


  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.041 0.002
lung adenocarcinoma -1.200 0.000
ovarian cancer -1.400 0.000


Accession O95926 Q5TH73
Symbols P29


  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid

 GO Function (1)

Gene RIF (6)

26260052 SYF2 might play a regulatory role in the proliferation of hepatocellular carcinoma cells.
25623116 we support that SYF2 might contribute to EOC progression via modulation of proliferation in EOC cells and would provide a novel therapeutic target of human epithelial ovarian cancer
25433998 p29 might contribute to the progression of non-small cell lung cancer by enhancing cell proliferation, implicating that targeting p29 might provide beneficial effects on the clinical therapy of non-small cell lung cancer
25034528 Our findings for the first time supported that SYF2 might play an important role in the regulation of esophageal squamous cell carcinoma proliferation
24985881 SYF2 in glioma is essential for cell proliferation.
16951160 novel function of p29 in the regulation of DNA replication checkpoint responses in Hela cells.

AA Sequence

INERNAKFNKKAERFYGKYTAEIKQNLERGTAV                                         211 - 243

Text Mined References (18)

PMID Year Title
26260052 2015 Overexpression of SYF2 correlates with enhanced cell growth and poor prognosis in human hepatocellular carcinoma.
25623116 2015 SYF2 is upregulated in human epithelial ovarian cancer and promotes cell proliferation.
25433998 2015 Involvement of p29/SYF2/fSAP29/NTC31 in the progression of NSCLC via modulating cell proliferation.
25416956 2014 A proteome-scale map of the human interactome network.
25034528 2014 Upregulation of SYF2 in esophageal squamous cell carcinoma promotes tumor cell proliferation and predicts poor prognosis.
24985881 2014 Knocking down the expression of SYF2 inhibits the proliferation of glioma cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.