Property Summary

NCBI Gene PubMed Count 16
PubMed Score 13.23
PubTator Score 91.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2716 6.7e-13
ovarian cancer 8520 2.1e-06
Multiple myeloma 1332 1.6e-03

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma -1.200 6.7e-13
Multiple myeloma 1.041 1.6e-03
ovarian cancer -1.400 2.1e-06

 GO Function (1)

Gene RIF (6)

AA Sequence

MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEA      1 - 70
KKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTK     71 - 140
QIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDY    141 - 210
INERNAKFNKKAERFYGKYTAEIKQNLERGTAV                                         211 - 243
//

Text Mined References (19)

PMID Year Title