Property Summary

NCBI Gene PubMed Count 30
PubMed Score 22.98
PubTator Score 51.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma 1.200 1.1e-03
medulloblastoma, large-cell 1.500 1.8e-04
osteosarcoma -1.195 4.6e-03
ovarian cancer 1.200 2.6e-08

Gene RIF (15)

AA Sequence

MGSSGLLSLLVLFVLLANVQGPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCL      1 - 70
DLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP            71 - 133
//

Text Mined References (31)

PMID Year Title