Property Summary

NCBI Gene PubMed Count 30
PubMed Score 19.68
PubTator Score 51.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.195 0.005
medulloblastoma, large-cell 1.500 0.000
adult high grade glioma 1.200 0.001
ovarian cancer 1.200 0.000

Gene RIF (15)

PMID Text
24358212 Eppin and Fibronectin bind to each other in human semen and on human ejaculated spermatozoa.
24312623 EPPIN and SEMG1 rapidly co-evolved in primates
22699487 EPPIN's semenogelin I binding site: a contraceptive drug target.
21461566 The expression of mouse EPPIN protein was detected in A1-A4 spermatogonia and the expression of human EPPIN was detected in type A spermatogonia as well as in the earliest preleptotene spermatocytes.
21392882 Letter: Eppin overexpression in prostate cancer correlates with favorable prognosis.
20488803 Different variants in the EPPIN gene are related to idiopathic male infertility and men carrying these variants have a decreased or increased risk of abnormal semen parameters associated with male infertility.
20488803 Observational study of gene-disease association. (HuGE Navigator)
20158997 Genetic variants in the Eppin gene may be associated with semen quality.
20158997 Observational study of gene-disease association. (HuGE Navigator)
19889947 Cysteine 239 of rSEMG1 appears to be the critical amino acid for both binding to eppin and inhibiting sperm motility.
More...

AA Sequence

MGSSGLLSLLVLFVLLANVQGPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCL      1 - 70
DLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP            71 - 133
//

Publication (31)

PMID Year Title
25494938 2015 De novo assembly of the transcriptome of Acanthaster planci testes.
24358212 2013 Correlation of epididymal protease inhibitor and fibronectin in human semen.
24312623 2013 Interacting proteins on human spermatozoa: adaptive evolution of the binding of semenogelin I to EPPIN.
22699487 2012 Characterization of EPPIN's semenogelin I binding site: a contraceptive drug target.
22075473 2012 Loss of calcium in human spermatozoa via EPPIN, the semenogelin receptor.
21461566 Distribution of Eppin in mouse and human testis.
21392882 2011 Eppin expression in prostate cancer.
20800364 2010 Eppin, a novel marker to differentially diagnose azoospermia?
20505168 2010 Alterations in the human blood-epididymis barrier in obstructive azoospermia and the development of novel epididymal cell lines from infertile men.
20488803 2010 Variants of the EPPIN gene affect the risk of idiopathic male infertility in the Han-Chinese population.
More...