Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.84
PubTator Score 5.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
posterior fossa group B ependymoma 416 9.1e-09
tuberculosis 2010 6.6e-05
psoriasis 6694 4.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Primary ciliary dyskinesia 76 3.443 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 1.200 9.1e-09
psoriasis 1.100 4.9e-03
tuberculosis 1.100 6.6e-05

 IMPC Phenotype (1)

Gene RIF (3)

AA Sequence

MAGKVKWVTDIEKSVLINNFEKRGWVQVTENEDWNFYWMSVQTIRNVFSVEAGYRLSDDQIVNHFPNHYE      1 - 70
LTRKDLMVKNIKRYRKELEKEGSPLAEKDENGKYLYLDFVPVTYMLPADYNLFVEEFRKSPSSTWIMKPC     71 - 140
GKAQGKGIFLINKLSQIKKWSRDSKTSSFVSQSNKEAYVISLYINNPLLIGGRKFDLRLYVLVSTYRPLR    141 - 210
CYMYKLGFCRFCTVKYTPSTSELDNMFVHLTNVAIQKHGEDYNHIHGGKWTVSNLRLYLESTRGKEVTSK    211 - 280
LFDEIHWIIVQSLKAVAPVMNNDKHCFECYGYDIIIDDKLKPWLIEVNASPSLTSSTANDRILKYNLIND    281 - 350
TLNIAVPNGEIPDCKWNKSPPKEVLGNYEILYDEELAQGDGADRELRSRQGQSLGPRAGRSRDSGRAVLT    351 - 420
TWK                                                                       421 - 423
//

Text Mined References (14)

PMID Year Title