Property Summary

NCBI Gene PubMed Count 13
PubMed Score 12.22
PubTator Score 5.09

Knowledge Summary

Patent (110)

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 5.1e-04
osteosarcoma 1.212 9.1e-06

Gene RIF (3)

AA Sequence

MVNQSSTPGFLLLGFSEHPGLERTLFVVVLTSYLLTLVGNTLIILLSALDPKLHSPMYFFLSNLSFLDLC      1 - 70
FTTSCVPQMLVNLWGPKKTISFLDCSVQIFIFLSLGTTECILLTVMAFDRYVAVCQPLHYATIIHPRLCW     71 - 140
QLASVAWVIGLVESVVQTPSTLHLPFCPDRQVDDFVCEVPALIRLSCEDTSYNEIQVAVASVFILVVPLS    141 - 210
LILVSYGAITWAVLRINSAKGRRKAFGTCSSHLTVVTLFYSSVIAVYLQPKNPYAQERGKFFGLFYAVGT    211 - 280
PSLNPLIYTLRNKEVTRAFRRLLGKEMGLTQS                                          281 - 312
//

Text Mined References (13)

PMID Year Title