Property Summary

NCBI Gene PubMed Count 13
PubMed Score 12.15
PubTator Score 5.09

Knowledge Summary

Patent (110)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.212 0.000
medulloblastoma, large-cell 1.200 0.001

Gene RIF (3)

PMID Text
19851445 Observational study of gene-disease association. (HuGE Navigator)
19833159 Observational study of gene-disease association. (HuGE Navigator)
17971048 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVNQSSTPGFLLLGFSEHPGLERTLFVVVLTSYLLTLVGNTLIILLSALDPKLHSPMYFFLSNLSFLDLC      1 - 70
FTTSCVPQMLVNLWGPKKTISFLDCSVQIFIFLSLGTTECILLTVMAFDRYVAVCQPLHYATIIHPRLCW     71 - 140
QLASVAWVIGLVESVVQTPSTLHLPFCPDRQVDDFVCEVPALIRLSCEDTSYNEIQVAVASVFILVVPLS    141 - 210
LILVSYGAITWAVLRINSAKGRRKAFGTCSSHLTVVTLFYSSVIAVYLQPKNPYAQERGKFFGLFYAVGT    211 - 280
PSLNPLIYTLRNKEVTRAFRRLLGKEMGLTQS                                          281 - 312
//

Publication (13)

PMID Year Title
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19833159 2010 Sequence variations at the human leukocyte antigen-linked olfactory receptor cluster do not influence female preferences for male odors.
17971048 2008 SNP mapping and candidate gene sequencing in the class I region of the HLA complex: searching for multiple sclerosis susceptibility genes in Tasmanians.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12637542 2003 Complex transcription and splicing of odorant receptor genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
11282967 2001 Characterization of clustered MHC-linked olfactory receptor genes in human and mouse.
More...