Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
Funding $77,250
PubMed Score 31.50
PubTator Score 14.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 1.800 0.009

Synonym

Accession O95907 Q9UBE2 MCT 3
Symbols MCT3
REMP

Gene

PANTHER Protein Class (1)

 Grant Application (1)

Gene RIF (1)

PMID Text
20424473 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGAGGPRRGEGPPDGGWGWVVLGACFVVTGFAYGFPKAVSVFFRALMRDFDAGYSDTAWVSSIMLAMLYG      1 - 70
TGPVSSILVTRFGCRPVMLAGGLLASAGMILASFATRLLELYLTAGVLTGLGLALNFQPSLIMLGLYFER     71 - 140
RRPLANGLAAAGSPVFLSALSPLGQQLLERFGWRGGFLLLGGLLLHCCACGAVMRPPPGPGPRPRRDSAG    141 - 210
DRAGDAPGEAEADGAGLQLREASPRVRPRRRLLDLAVCTDRAFAVYAVTKFLMALGLFVPAILLVNYAKD    211 - 280
AGVPDTDAAFLLSIVGFVDIVARPACGALAGLARLRPHVPYLFSLALLANGLTDLSSARARSYGALVAFC    281 - 350
VAFGLSYGMVGALQFEVLMAAVGAPRFPSALGLVLLVEAAAVLIGPPSAGRLVDVLKNYEIIFYLAGSEV    351 - 420
ALAGVFMAVATNCCLRCAKAAPSGPGTEGGASDTEDAEAEGDSEPLPVVAEEPGNLEALEVLSARGEPTE    421 - 490
PEIEARPRLAAESV                                                            491 - 504
//

Publication (9)

PMID Year Title
23455636 2013 Seven new loci associated with age-related macular degeneration.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
15917240 2005 Basigin (CD147) is the target for organomercurial inhibition of monocarboxylate transporter isoforms 1 and 4: the ancillary protein for the insensitive MCT2 is EMBIGIN (gp70).
12739169 2004 The SLC16 gene family-from monocarboxylate transporters (MCTs) to aromatic amino acid transporters and beyond.
12657613 2003 Polarized expression of monocarboxylate transporters in human retinal pigment epithelium and ARPE-19 cells.
10591208 1999 The DNA sequence of human chromosome 22.
10493836 1999 Cloning of the human monocarboxylate transporter MCT3 gene: localization to chromosome 22q12.3-q13.2.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7273846 1981 The glucose-lactic acid cycle and gluconeogenesis.