Property Summary

NCBI Gene PubMed Count 20
Grant Count 11
R01 Count 7
Funding $485,817.13
PubMed Score 9.74
PubTator Score 30.10

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
26711270 The interaction of ECD with RUVBL1, and its CK2-mediated phosphorylation, independent of its interaction with PIH1D1, are important for its cell cycle regulatory function.
25616580 Ecdysoneless and H-Ras expressing human mammary epithelial cells form tumors in NOD/SCID mice.
23880345 TXNIP has a role in the pathway involving hEcd to increase p53 stability and activity
22977192 Ecd is a novel tumor-promoting factor that is differentially expressed in pancreatic cancer and potentially regulates glucose metabolism within cancer cells.
22270930 Ecd as a novel marker for breast cancer progression and show that levels of Ecd expression predict poorer survival in Her2/neu overexpressing breast cancer patients.
22113445 Serum HER2/ECD concentration of >/=7.7 ng/ml has possible diagnostic value in stage I and II breast cancer. It should not be used as a determinant of HER2 positivity.
19919181 Ecd localizes to both nucleus & cytoplasm & shuttles between the nucleus and cytoplasm; however, it exhibits strong nuclear export. Based on previous yeast studies & evidence provided here, we suggest that Ecd functions as a transcriptional regulator.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEETMKLATMEDTVEYCLFLIPDESRDSDKHKEILQKYIERIITRFAPMLVPYIWQNQPFNLKYKPGKGG      1 - 70
VPAHMFGVTKFGDNIEDEWFIVYVIKQITKEFPELVARIEDNDGEFLLIEAADFLPKWLDPENSTNRVFF     71 - 140
CHGELCIIPAPRKSGAESWLPTTPPTIPQALNIITAHSEKILASESIRAAVNRRIRGYPEKIQASLHRAH    141 - 210
CFLPAGIVAVLKQRPRLVAAAVQAFYLRDPIDLRACRVFKTFLPETRIMTSVTFTKCLYAQLVQQRFVPD    211 - 280
RRSGYRLPPPSDPQYRAHELGMKLAHGFEILCSKCSPHFSDCKKSLVTASPLWASFLESLKKNDYFKGLI    281 - 350
EGSAQYRERLEMAENYFQLSVDWPESSLAMSPGEEILTLLQTIPFDIEDLKKEAANLPPEDDDQWLDLSP    351 - 420
DQLDQLLQEAVGKKESESVSKEEKEQNYDLTEVSESMKAFISKVSTHKGAELPREPSEAPITFDADSFLN    421 - 490
YFDKILGPRPNESDSDDLDDEDFECLDSDDDLDFETHEPGEEASLKGTLDNLKSYMAQMDQELAHTCISK    491 - 560
SFTTRNQVEPVSQTTDNNSDEEDSGTGESVMAPVDVDLNLVSNILESYSSQAGLAGPASNLLQSMGVQLP    561 - 630
DNTDHRPTSKPTKN                                                            631 - 644
//

Publication (29)

PMID Year Title
26711270 2015 A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression.
25616580 2015 The cell cycle regulator ecdysoneless cooperates with H-Ras to promote oncogenic transformation of human mammary epithelial cells.
24722212 2014 Unexpected role of the steroid-deficiency protein ecdysoneless in pre-mRNA splicing.
24656813 2014 Phosphorylation-dependent PIH1D1 interactions define substrate specificity of the R2TP cochaperone complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23935490 2013 The Salmonella type III effector SspH2 specifically exploits the NLR co-chaperone activity of SGT1 to subvert immunity.
23880345 2013 TXNIP interacts with hEcd to increase p53 stability and activity.
22977192 2012 Overexpression of ecdysoneless in pancreatic cancer and its role in oncogenesis by regulating glycolysis.
22270930 2012 Overexpression of a novel cell cycle regulator ecdysoneless in breast cancer: a marker of poor prognosis in HER2/neu-overexpressing breast cancer patients.
22113445 2011 Serum HER2/ECD value in stage I and II early breast cancer: need of a lower cut-off?
More...