Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.76
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma, large-cell 6241 1.6e-05
adult high grade glioma 3801 3.8e-04
medulloblastoma 720 1.6e-03
Disease Target Count Z-score Confidence
Obesity 678 0.0 0.9
Disease Target Count Z-score Confidence
Dyskeratosis congenita 24 4.057 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.100 3.8e-04
medulloblastoma -1.100 1.6e-03
medulloblastoma, large-cell -1.200 1.6e-05

AA Sequence

MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRVRFLLGPMEGSEEKELTLTAT      1 - 70
SVPSFINHPLVCGPAFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDD     71 - 140
FREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITG    141 - 210
IRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQVRRTRDGFFTLDSALLRTQWDLTNIQ    211 - 280
DAIRAATPQVAAELEKSLSPGLDTKQLPSPGWSWDSQGPSSTLGLERGAGQ                       281 - 331
//

Text Mined References (14)

PMID Year Title