Property Summary

NCBI Gene PubMed Count 13
PubMed Score 12.49
PubTator Score 7.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Astrocytoma, Pilocytic 3081 2.9e-04
group 3 medulloblastoma 4104 4.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Glaucoma 239 3.996 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
Astrocytoma, Pilocytic 1.600 2.9e-04
group 3 medulloblastoma -1.100 4.7e-02

Gene RIF (4)

AA Sequence

MWPLTVPPPLLLLLCSGLAGQTLFQNPEEGWQLYTSAQAPDGKCICTAVIPAQSTCSRDGRSRELRQLME      1 - 70
KVQNVSQSMEVLELRTYRDLQYVRGMETLMRSLDARLRAADGSLSAKSFQELKDRMTELLPLSSVLEQYK     71 - 140
ADTRTIVRLREEVRNLSGSLAAIQEEMGAYGYEDLQQRVMALEARLHACAQKLGCGKLTGVSNPITVRAM    141 - 210
GSRFGSWMTDTMAPSADSRVWYMDGYYKGRRVLEFRTLGDFIKGQNFIQHLLPQPWAGTGHVVYNGSLFY    211 - 280
NKYQSNVVVKYHFRSRSVLVQRSLPGAGYNNTFPYSWGGFSDMDFMVDESGLWAVYTTNQNAGNIVVSRL    281 - 350
DPHTLEVMRSWDTGYPKRSAGEAFMICGVLYVTNSHLAGAKVYFAYFTNTSSYEYTDVPFHNQYSHISML    351 - 420
DYNPRERALYTWNNGHQVLYNVTLFHVISTSGDP                                        421 - 454
//

Text Mined References (14)

PMID Year Title