Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.85
PubTator Score 7.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
pilocytic astrocytoma 3086 2.22735681401611E-4
group 3 medulloblastoma 2254 0.0472718578637809
Disease Target Count Z-score Confidence
Glaucoma 135 3.889 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.100 0.047
pilocytic astrocytoma 1.700 0.000

Synonym

Accession O95897 Q6IMJ3 Q96FC2
Symbols NOE2
OlfC
NOELIN2
NOELIN2_V1

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

 GWAS Trait (1)

Gene RIF (3)

PMID Text
25298399 Olfm2 physically interacts with serum response factor (SRF) without affecting the SRF-myocardin interaction.
17122126 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17122126 The Arg144Gln mutation in OLFM2 is a possible disease-causing mutation in Japanese patients with OAG. Common polymorphisms in OLFM2 and OPTN may interactively contribute to the development of OAG, indicating a polygenic etiology.

AA Sequence

MWPLTVPPPLLLLLCSGLAGQTLFQNPEEGWQLYTSAQAPDGKCICTAVIPAQSTCSRDGRSRELRQLME      1 - 70
KVQNVSQSMEVLELRTYRDLQYVRGMETLMRSLDARLRAADGSLSAKSFQELKDRMTELLPLSSVLEQYK     71 - 140
ADTRTIVRLREEVRNLSGSLAAIQEEMGAYGYEDLQQRVMALEARLHACAQKLGCGKLTGVSNPITVRAM    141 - 210
GSRFGSWMTDTMAPSADSRVWYMDGYYKGRRVLEFRTLGDFIKGQNFIQHLLPQPWAGTGHVVYNGSLFY    211 - 280
NKYQSNVVVKYHFRSRSVLVQRSLPGAGYNNTFPYSWGGFSDMDFMVDESGLWAVYTTNQNAGNIVVSRL    281 - 350
DPHTLEVMRSWDTGYPKRSAGEAFMICGVLYVTNSHLAGAKVYFAYFTNTSSYEYTDVPFHNQYSHISML    351 - 420
DYNPRERALYTWNNGHQVLYNVTLFHVISTSGDP                                        421 - 454
//

Text Mined References (13)

PMID Year Title
25298399 2014 Olfactomedin 2, a novel regulator for transforming growth factor-?-induced smooth muscle differentiation of human embryonic stem cell-derived mesenchymal cells.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
21228389 2011 Olfactomedin 2: expression in the eye and interaction with other olfactomedin domain-containing proteins.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
17122126 2006 SNPs and interaction analyses of noelin 2, myocilin, and optineurin genes in Japanese patients with open-angle glaucoma.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15123989 2004 Bioinformatic approaches for identification and characterization of olfactomedin related genes with a potential role in pathogenesis of ocular disorders.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
More...