Property Summary

NCBI Gene PubMed Count 19
PubMed Score 34.59
PubTator Score 51.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Expression

  Differential Expression (2)

Disease log2 FC p
juvenile dermatomyositis 1.036 0.000
ovarian cancer 1.800 0.000

Synonym

Accession O95881 B3KQS0 Q5T1T4 Q96H50
Symbols AG1
AGR1
ERP16
ERP18
ERP19
TLP19
hAG-1
PDIA16
hTLP19

Gene

PANTHER Protein Class (2)

PDB

1SEN   2K8V  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (5)

PMID Text
25940440 We conclude that ERp19 contributes to tumorigenicity and metastasis of gastric cancer
19887585 ERp18 shows specificity towards a component of the complement cascade, pentraxin-related protein PTX3.
19361226 the solution structure of oxidized ERp18 as determined using NMR spectroscopy
18628206 ERp16 mediates disulfide bond formation in the ER and plays an important role in cellular defense against prolonged ER stress
12761212 putative physiological role for endoplasmic reticulum thioredoxin superfamily member p18(ERp18) in native disulfide bond formation is discussed

AA Sequence

METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACK      1 - 70
ALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYF     71 - 140
YVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL                                          141 - 172
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25940440 2015 ERp19 contributes to tumorigenicity in human gastric cancer by promoting cell growth, migration and invasion.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
19887585 2009 Protein disulphide isomerase family members show distinct substrate specificity: P5 is targeted to BiP client proteins.
19361226 2009 Solution structure and dynamics of ERp18, a small endoplasmic reticulum resident oxidoreductase .
18628206 2008 ERp16, an endoplasmic reticulum-resident thiol-disulfide oxidoreductase: biochemical properties and role in apoptosis induced by endoplasmic reticulum stress.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...