Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.61
PubTator Score 161.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.8e-09

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.721 2.8e-09

Gene RIF (5)

AA Sequence

MFLRRLGGWLPRPWGRRKPMRPDPPYPEPRRVDSSSENSGSDWDSAPETMEDVGHPKTKDSGALRVSGAA      1 - 70
SEPSKEEPQVEQLGSKRMDSLKWDQPISSTQESGRLEAGGASPKLRWDHVDSGGTRRPGVSPEGGLSVPG     71 - 140
PGAPLEKPGRREKLLGWLRGEPGAPSRYLGGPEECLQISTNLTLHLLELLASALLALCSRPLRAALDTLG    141 - 210
LRGPLGLWLHGLLSFLAALHGLHAVLSLLTAHPLHFACLFGLLQALVLAVSLREPNGDEAATDWESEGLE    211 - 280
REGEEQRGDPGKGL                                                            281 - 294
//

Text Mined References (13)

PMID Year Title