Property Summary

NCBI Gene PubMed Count 23
PubMed Score 46.06
PubTator Score 5.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Obesity 616
Disease Target Count P-value
ovarian cancer 8492 7.2751656949207E-6
osteosarcoma 7933 1.63659696196357E-4

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.060 0.000
ovarian cancer -1.100 0.000

Gene RIF (11)

PMID Text
25290914 BAT5 is a genuine lipase with preference for long-chain unsaturated monoacylglycerols, and could in this capacity regulate glycerolipid metabolism in vivo as well.
21044367 Observational study of gene-disease association. (HuGE Navigator)
20626023 Results suggest BAT2 -8671, BAT3 8854, and BAT5 22655, 9569 SNPs as well as BAT haplotypes (ATTGTG and ATCATG) might be associated with higher Kawasaki disease susceptibility and coronary artery aneurysm formation.
20626023 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19116923 Observational study of gene-disease association. (HuGE Navigator)
19115949 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18835879 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAKLLSCVLGPRLYKIYRERDSERAPASVPETPTAVTAPHSSSWDTYYQPRALEKHADSILALASVFWSI      1 - 70
SYYSSPFAFFYLYRKGYLSLSKVVPFSHYAGTLLLLLAGVACLRGIGRWTNPQYRQFITILEATHRNQSS     71 - 140
ENKRQLANYNFDFRSWPVDFHWEEPSSRKESRGGPSRRGVALLRPEPLHRGTADTLLNRVKKLPCQITSY    141 - 210
LVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQK    211 - 280
LVICCEGNAGFYEVGCVSTPLEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDII    281 - 350
IYAWSIGGFTATWAAMSYPDVSAMILDASFDDLVPLALKVMPDSWRGLVTRTVRQHLNLNNAEQLCRYQG    351 - 420
PVLLIRRTKDEIITTTVPEDIMSNRGNDLLLKLLQHRYPRVMAEEGLRVVRQWLEASSQLEEASIYSRWE    421 - 490
VEEDWCLSVLRSYQAEHGPDFPWSVGEDMSADGRRQLALFLARKHLHNFEATHCTPLPAQNFQMPWHL      491 - 558
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25290914 2014 Biochemical and pharmacological characterization of the human lymphocyte antigen B-associated transcript 5 (BAT5/ABHD16A).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20626023 2010 Human lymphocyte antigen B-associated transcript 2, 3, and 5 polymorphisms and haplotypes are associated with susceptibility of Kawasaki disease and coronary artery aneurysm.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19116923 2009 Genetic association of the major histocompatibility complex with rheumatoid arthritis implicates two non-DRB1 loci.
19115949 2009 Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).
18835879 2008 Fine mapping of the MHC Class III region demonstrates association of AIF1 and rheumatoid arthritis.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
2911734 1989 A new cluster of genes within the human major histocompatibility complex.
2813433 1989 Human major histocompatibility complex contains a minimum of 19 genes between the complement cluster and HLA-B.