Property Summary

NCBI Gene PubMed Count 23
PubMed Score 46.73
PubTator Score 5.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Obesity 655
Disease Target Count P-value
ovarian cancer 8297 7.3e-06
osteosarcoma 7766 1.6e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.060 1.6e-04
ovarian cancer -1.100 7.3e-06

Gene RIF (12)

AA Sequence

MAKLLSCVLGPRLYKIYRERDSERAPASVPETPTAVTAPHSSSWDTYYQPRALEKHADSILALASVFWSI      1 - 70
SYYSSPFAFFYLYRKGYLSLSKVVPFSHYAGTLLLLLAGVACLRGIGRWTNPQYRQFITILEATHRNQSS     71 - 140
ENKRQLANYNFDFRSWPVDFHWEEPSSRKESRGGPSRRGVALLRPEPLHRGTADTLLNRVKKLPCQITSY    141 - 210
LVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQK    211 - 280
LVICCEGNAGFYEVGCVSTPLEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDII    281 - 350
IYAWSIGGFTATWAAMSYPDVSAMILDASFDDLVPLALKVMPDSWRGLVTRTVRQHLNLNNAEQLCRYQG    351 - 420
PVLLIRRTKDEIITTTVPEDIMSNRGNDLLLKLLQHRYPRVMAEEGLRVVRQWLEASSQLEEASIYSRWE    421 - 490
VEEDWCLSVLRSYQAEHGPDFPWSVGEDMSADGRRQLALFLARKHLHNFEATHCTPLPAQNFQMPWHL      491 - 558
//

Text Mined References (24)

PMID Year Title