Property Summary

Ligand Count 2
NCBI Gene PubMed Count 23
PubMed Score 46.73
PubTator Score 5.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Obesity 678
Disease Target Count P-value
ovarian cancer 8520 7.3e-06
osteosarcoma 7950 1.6e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.060 1.6e-04
ovarian cancer -1.100 7.3e-06

Gene RIF (12)

AA Sequence

MAKLLSCVLGPRLYKIYRERDSERAPASVPETPTAVTAPHSSSWDTYYQPRALEKHADSILALASVFWSI      1 - 70
SYYSSPFAFFYLYRKGYLSLSKVVPFSHYAGTLLLLLAGVACLRGIGRWTNPQYRQFITILEATHRNQSS     71 - 140
ENKRQLANYNFDFRSWPVDFHWEEPSSRKESRGGPSRRGVALLRPEPLHRGTADTLLNRVKKLPCQITSY    141 - 210
LVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQK    211 - 280
LVICCEGNAGFYEVGCVSTPLEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDII    281 - 350
IYAWSIGGFTATWAAMSYPDVSAMILDASFDDLVPLALKVMPDSWRGLVTRTVRQHLNLNNAEQLCRYQG    351 - 420
PVLLIRRTKDEIITTTVPEDIMSNRGNDLLLKLLQHRYPRVMAEEGLRVVRQWLEASSQLEEASIYSRWE    421 - 490
VEEDWCLSVLRSYQAEHGPDFPWSVGEDMSADGRRQLALFLARKHLHNFEATHCTPLPAQNFQMPWHL      491 - 558
//

Text Mined References (24)

PMID Year Title