Property Summary

NCBI Gene PubMed Count 8
PubMed Score 25.74
PubTator Score 5.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.0e-07

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 3.0e-07

Gene RIF (4)

AA Sequence

MKPQFVGILLSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPA      1 - 70
CVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNSAVASHVAPAGILAAAATALTCLLPGLWSG            71 - 133
//

Text Mined References (11)

PMID Year Title