Property Summary

NCBI Gene PubMed Count 7
PubMed Score 22.37
PubTator Score 5.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Synonym

Accession O95868 A2BEY8 B0UXC1 B0V019 B0V1Y6 Q4VX50 Protein Ly6-D
Symbols G6D
NG25
LY6-D
MEGT1
C6orf23

Gene

  Ortholog (1)

Species Source
Dog EggNOG Inparanoid

Gene RIF (4)

PMID Text
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19807019 Frequencies of the DRB1, DQA1, DQB1 and TNFA alleles in immigrant population of West Siberia
19423540 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKPQFVGILLSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPA      1 - 70
CVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNSAVASHVAPAGILAAAATALTCLLPGLWSG            71 - 133
//

Text Mined References (11)

PMID Year Title
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19807019 [Detection of LY6G6D gene exon-intron structure,].
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
17008713 2006 Characterization of the five novel Ly-6 superfamily members encoded in the MHC, and detection of cells expressing their potential ligands.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12079290 2002 Transcriptional analysis of a novel cluster of LY-6 family members in the human and mouse major histocompatibility complex: five genes with many splice forms.
More...