Property Summary

NCBI Gene PubMed Count 9
PubMed Score 11.01
PubTator Score 0.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
periodontitis 293 3.3e-16
psoriasis 6694 7.8e-04
diabetes mellitus 1728 2.0e-03
Atopic dermatitis 952 4.0e-03
esophageal adenocarcinoma 737 2.7e-02
Disease Target Count Z-score Confidence
Tonsil cancer 1 3.032 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis -1.400 4.0e-03
diabetes mellitus 1.300 2.0e-03
esophageal adenocarcinoma -1.900 2.7e-02
periodontitis -1.100 3.3e-16
psoriasis -1.500 7.8e-04

Gene RIF (3)

AA Sequence

MKALMLLTLSVLLCWVSADIRCHSCYKVPVLGCVDRQSCRLEPGQQCLTTHAYLGKMWVFSNLRCGTPEE      1 - 70
PCQEAFNQTNRKLGLTYNTTCCNKDNCNSAGPRPTPALGLVFLTSLAGLGLWLLH                    71 - 125
//

Text Mined References (11)

PMID Year Title