Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.79
PubTator Score 32.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
THROMBOCYTOPENIA, ANEMIA, AND MYELOFIBROSIS 1 0.0 0.0

Expression

Gene RIF (9)

AA Sequence

MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSG      1 - 70
TPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVY     71 - 140
PQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRFAPLVKTEPQRPVKEEEPKIPGDLDQEPSLL    141 - 210
YADLDHLALSRPRRLSTADPADASTIYAVVV                                           211 - 241
//

Text Mined References (22)

PMID Year Title